KEGG   Saccharopolyspora erythraea: SACE_4499Help
Entry
SACE_4499         CDS       T00492                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sen  Saccharopolyspora erythraea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACE_4499 (folP)
Enzymes [BR:sen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SACE_4499 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
5030403..5031302
Genome map
AA seq 299 aa AA seqDB search
MTITSELLTGEPNPPPSGGAAGGAPLLQRLRAPRPLLCGIVNVTPDSFSDGGSYLDHSAA
VAHGLRLAEEGADIIDVGGESTRPGARQPGVAEELERVVPVVERLSRATSVPVSVDTSRP
EVMRAAVAAGAGLINDVRALREPGALPAAAELGVPVCLMHMQGSPGVMQRDPRYADVLGE
VVSFLRRRVDECSAAGIPPGHLVVDPGFGFGKTLEHNLDLLASLPALGRLGLPVMVGLSR
KSMLGQITGRTVRHRQAASVTAAVLAAQRGAKILRVHDVAATSDALKLLGAVAAAEVPR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcacctccgaactcctcaccggcgagccgaatccgccacccagcggcggagcc
gccgggggcgcgccgctgctccagcggctgcgcgcccctcggccgctgctgtgcggcatc
gtcaacgtgactccggattccttctccgacggaggctcctacctcgaccacagcgcggcg
gtcgcccacggccttcgacttgccgaggaaggcgccgacatcatcgacgtcggcggtgag
tccacgcgccccggcgcacggcaacccggcgtcgccgaggagctggagcgggtggttccg
gtcgtcgagcggctctcgcgggcgacctcggtgccggtgtccgtggacacctcgcgcccg
gaggtgatgcgcgcggccgtggccgccggcgccggcctgatcaacgacgtgcgggcgctg
cgagagccgggggcgctgccggccgcggcggagctgggcgtaccggtctgcctgatgcac
atgcagggctcacccggcgtcatgcaacgcgacccgcgctacgccgacgtcctcggcgag
gtcgtgtccttcctccgccggcgcgtcgacgagtgctccgcggccggcatcccgcccgga
catctcgtcgtcgatcccggattcgggttcggcaagacgctggagcacaacctggacctg
ctggcgtcactgcctgccttggggcggttgggtctgcccgtcatggtcgggctgtcccgc
aagagcatgctcggccagatcaccggccgcacggtgcggcaccgccaggcggcctcggtc
accgcggcggtgctggcggcccagcgcggggcgaagatcctcagggtccacgacgtcgcg
gcgaccagcgatgcgctcaagctgctcggcgcggtggccgccgcggaggtgccgcgatga

DBGET integrated database retrieval system