KEGG   Saccharopolyspora erythraea: SACE_4499Help
Entry
SACE_4499         CDS       T00492                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00790  Folate biosynthesis
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACE_4499 (folP)
Enzymes [BR:sen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SACE_4499 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: CAM03768
Cambridge: SACE_4499
Kitasato: SACE_4499
UniProt: A4FI93
Position
5030403..5031302
Genome map
AA seq 299 aa AA seqDB search
MTITSELLTGEPNPPPSGGAAGGAPLLQRLRAPRPLLCGIVNVTPDSFSDGGSYLDHSAA
VAHGLRLAEEGADIIDVGGESTRPGARQPGVAEELERVVPVVERLSRATSVPVSVDTSRP
EVMRAAVAAGAGLINDVRALREPGALPAAAELGVPVCLMHMQGSPGVMQRDPRYADVLGE
VVSFLRRRVDECSAAGIPPGHLVVDPGFGFGKTLEHNLDLLASLPALGRLGLPVMVGLSR
KSMLGQITGRTVRHRQAASVTAAVLAAQRGAKILRVHDVAATSDALKLLGAVAAAEVPR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcacctccgaactcctcaccggcgagccgaatccgccacccagcggcggagcc
gccgggggcgcgccgctgctccagcggctgcgcgcccctcggccgctgctgtgcggcatc
gtcaacgtgactccggattccttctccgacggaggctcctacctcgaccacagcgcggcg
gtcgcccacggccttcgacttgccgaggaaggcgccgacatcatcgacgtcggcggtgag
tccacgcgccccggcgcacggcaacccggcgtcgccgaggagctggagcgggtggttccg
gtcgtcgagcggctctcgcgggcgacctcggtgccggtgtccgtggacacctcgcgcccg
gaggtgatgcgcgcggccgtggccgccggcgccggcctgatcaacgacgtgcgggcgctg
cgagagccgggggcgctgccggccgcggcggagctgggcgtaccggtctgcctgatgcac
atgcagggctcacccggcgtcatgcaacgcgacccgcgctacgccgacgtcctcggcgag
gtcgtgtccttcctccgccggcgcgtcgacgagtgctccgcggccggcatcccgcccgga
catctcgtcgtcgatcccggattcgggttcggcaagacgctggagcacaacctggacctg
ctggcgtcactgcctgccttggggcggttgggtctgcccgtcatggtcgggctgtcccgc
aagagcatgctcggccagatcaccggccgcacggtgcggcaccgccaggcggcctcggtc
accgcggcggtgctggcggcccagcgcggggcgaagatcctcagggtccacgacgtcgcg
gcgaccagcgatgcgctcaagctgctcggcgcggtggccgccgcggaggtgccgcgatga

DBGET integrated database retrieval system