KEGG   Saccharopolyspora erythraea: SACE_4519Help
Entry
SACE_4519         CDS       T00492                                 

Definition
GroES-like alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SACE_4519
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4519
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_4519
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_4519
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_4519
   00626 Naphthalene degradation
    SACE_4519
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_4519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(5052679..5053701)
Genome map
AA seq 340 aa AA seqDB search
MAPGETMAAWVVEAPAPVERGPLSPRDLPLPRAADDELLVRVSVCGVCRTDLHVAEGDLP
PHRPAVVPGHEVVGRVVACGAATTGFGEGDRVGIAWLRRTCQRCVYCRRGRENLCPNSRY
TGWDADGGYAEYTTVPADYAYHLPEGYSDEESAPLLCAGLIGYRAWLRARLPEGGSLGIY
GFGASAHLTAQVAMASGATVHVLTRSAQARELALELGAASAGGAGDRPPEPLDSAVLFAP
VGELVPVALEALDRGGTLAIAGIHLTDVPPLNYQRHLFLERNLCSVTANTRQDGQEFLRF
AARHRMRVTTTPYPFAAADRALDDLAHDRVNGAAVIRVAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctccgggcgagacgatggcggcgtgggtggtggaggctcccgcaccggtggagcgc
ggaccgctcagtccgagggacctcccgctaccgcgggccgcggatgacgaactgctggtg
cgggtgtcggtgtgcggggtctgccgcacggacctgcacgtcgccgaaggtgatcttccg
ccgcacaggccggcggtggtccccggccacgaggtggtcgggcgcgtggtggcgtgcggt
gcggcgacgacggggttcggcgagggagaccgcgtcggcatcgcctggttgcgccgcacc
tgccaacggtgcgtgtactgccgcaggggccgggagaacctgtgcccgaactcccgctac
accgggtgggacgctgacggcggctacgccgagtacaccaccgtgcccgccgattacgcc
taccacctgccggagggctactccgatgaggagtccgcgccgttgctgtgcgcggggctg
atcggctatcgggcgtggttgcgggcccggctccccgagggcggcagcctgggcatctac
ggcttcggtgccagcgcgcatctgaccgcccaggtcgccatggccagcggtgcgacggtg
catgtgctgacgcgttcggcgcaggcgcgggagctggcgctcgaactgggcgcggcctcg
gcgggcggggcgggcgaccgtccgccggagccgctggactcggcggtgctgttcgcgccg
gtcggagagctcgtgcccgtcgcgctggaggcgctggaccggggcgggaccctggcgatc
gcgggcatccacctcaccgacgtgccgccgctgaactaccagcggcacctgttcctcgaa
cggaacctgtgcagcgtcaccgccaacacgcgccaggacggtcaggagttcctgcggttc
gccgcgcgccaccggatgcgggtcaccacgaccccctacccgttcgcggcggccgaccgg
gcgctggacgacctcgcccacgaccgggtgaacggcgcggcggtcatcagggtcgccgcc
tga

DBGET integrated database retrieval system