KEGG   Saccharopolyspora erythraea: SACE_4756Help
Entry
SACE_4756         CDS       T00492                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase, dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00020  Citrate cycle (TCA cycle)
sen00620  Pyruvate metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Module
sen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4756 (acoC)
   00020 Citrate cycle (TCA cycle)
    SACE_4756 (acoC)
   00620 Pyruvate metabolism
    SACE_4756 (acoC)
Enzymes [BR:sen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SACE_4756 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Ser_hydrolase Ndr DUF676 Biotin_lipoyl_2 Thioesterase Abhydrolase_5 Esterase
Motif
Other DBs
NCBI-ProteinID: CAM04024
Cambridge: SACE_4756
Kitasato: SACE_4756
UniProt: A4FIZ9
Position
5315898..5317013
Genome map
AA seq 371 aa AA seqDB search
MTDERIHRVTMPKWGLSMTTGKITDWWASEGDDVSDGDDLAEIDTDKIAGTLESTGEGVL
RRIVVAAGSDAPVGATIAVVAPAEVPDSEIDEVVAEAQEQLASGEVEEAAGPAVAEVDVG
GRMISYASMGEGPQAVVLVHGFGGDKNSWLFVQEPLAEGRTVYALDLPGHGASTKDVGDG
SVNELAATLIAFLDELGIERAHLVGHSLGGAVVTNAAASVPDRVRSLTLIAPAGIGSEVD
AEYLRGFVAASTRRELKPHLRKLFADESQVTRRLVDDLLKYKRIDGVQEALETLLGTLLH
GEAQAIDTGPMLAEADVPLAVVWGRQDAVLPSANASALGDRVEVRFVDGAGHMVHMENPH
ATREAIESVLR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagcggattcaccgggtcaccatgcccaagtggggcctgtcgatgaccacc
ggcaagatcaccgactggtgggcctccgagggcgacgacgtctccgacggcgacgacctc
gccgagatcgacaccgacaagatcgcgggcaccctggagtccaccggcgagggcgtcctg
cgccggatcgtggtggccgcgggctcggacgcaccggtcggcgcgacgatcgcggtcgtc
gcgcccgccgaggtgcccgacagcgagatcgacgaggtggtcgccgaggcgcaggagcag
ctggcctccggcgaggtcgaggaggcggccggtccggcggtggccgaggtcgacgtcggc
ggccggatgatctcctacgcgtcgatgggcgagggcccgcaggcggtcgtgctggtccac
ggcttcggcggcgacaagaactcctggctgttcgtccaggaaccgctggcggagggccgc
accgtctacgcgctcgacctgcccgggcacggcgcgtcgaccaaggacgtcggcgacgga
tcggtgaacgagctggcggccaccctcatcgcattcctcgacgagctgggcatcgagcgg
gcgcacctggtgggccactccctcggcggggccgtggtcaccaacgccgcggcgtcggtc
ccggaccgggtgcggtcgctgacgctgatcgcacccgccggaatcgggtccgaagtggac
gccgagtacctgcgcgggttcgtggcggcgagcacccgccgggagctcaaaccgcacctg
cgcaagctgttcgccgacgagtcccaggtgacccgccggctggtcgacgacctgctgaag
tacaagcggatcgacggcgtgcaggaggcgctggaaaccctgctgggcaccctgctgcac
ggcgaggcccaggccatcgacaccgggccgatgctggcggaggccgacgtgccgctggcg
gtggtctggggccgccaggacgcggtgctgccgagcgcgaacgcctcggcgctcggcgac
cgcgtggaggtgcgcttcgtcgacggcgccgggcacatggtgcacatggagaacccgcac
gccacccgagaagccatcgagtccgtgctgcgctga

DBGET integrated database retrieval system