KEGG   Saccharopolyspora erythraea: SACE_5154Help
Entry
SACE_5154         CDS       T00492                                 

Gene name
bga2
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sen00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(5763008..5765020)
Genome map
AA seq 670 aa AA seqDB search
MTEPQAARRFRERIATIAYGGDYNPEQWPREVWREDIRLMSEAGISLVSVGIFGWALVEP
RPGDFDFGWFDQVLDNLAEGGVAASVATMTASPPPWLARKFPETLPQRADGTILWPGARQ
AYCPSSPVYREHALRLVEKLAERYAQHPALALWHIGNEYGCHVRACYCDSSALAFRDWLR
ERYGDVSELNEAWSTKFWSQRYDDFDEILPPRTAPTFANPAQRLDFARFSSDTMLELLRM
EKAVLRRVTPEIPVTTNHVPLARTLDLHAWSSEVDVVGYDSYPDPHDPRAHVLAGLSYDV
FRSLRGGQPWLLMEQAPNAVNWRPRNAAKAPGQMRLWSWQAVAQGADGVLFFQWRQSAGG
AEKFHSGMVPHAGTDTRTFREVTELGAELAAAGELAGTRPDNDVALVLDWDSWWALELDS
HPSELGQVDALLAHYGPLFDAGIGCDVVHPDRDLSGYRLVVVPNLYLLRETTAANLTDHV
RRGGHLLVSFFSGIVDENDRVHLGGYPAPLREVLGLRIPEFQPLAEGAGIGVELLGSAAR
ATLWSEKIEPKGASVLGTFTEGALAGHPALTRHAFGDGAAWYLATRPEPEAMRTLIDRVT
AEAGVQPVLADLPAGVQATRRGEFFFLLNHNAVEVKVRLPWPAADLLTGAQAAEVTLPPR
GVAVLKPVER
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaccgcaggccgcccgccgattccgggagcgcatcgccaccatcgcctacgga
ggggactacaaccccgagcagtggccgcgggaggtgtggcgcgaagacatccgattgatg
agcgaggccgggatttccctggtgtcggtgggcatcttcggctgggcgctggtggaaccg
cggcccggcgacttcgacttcggctggttcgaccaggtgctggacaacctcgccgagggc
ggtgtcgcggcttcggtcgcgacgatgaccgcctcgccgccgccgtggctcgcgaggaag
ttcccggaaacgctgccgcaacgcgccgacggcaccatcctgtggccgggcgcccggcag
gcgtactgcccgtccagcccggtctaccgcgagcacgcgctgcggctcgtcgagaaactc
gccgaacgctacgcccagcacccagcgctggcgttgtggcacatcggcaacgagtacggc
tgccacgtccgcgcctgctactgcgacagctcggcgctggccttccgcgactggctgcgc
gagcgctacggcgacgtctccgagctcaacgaggcgtggtcgacgaagttctggtcccag
cgctacgacgacttcgacgagatcctgccgccgcgcaccgcgccgaccttcgccaacccg
gcgcaacggctggacttcgcccgcttctcctcggacaccatgctggagctgctgcggatg
gagaaggcggtcctgcgccgcgtcacgccggagatcccggtgaccaccaaccacgttccg
ctggccaggaccctggacctgcacgcgtggtcgtccgaagtggacgtcgtcggctacgac
tcctaccccgacccgcacgacccgcgcgcccacgtgctggccggcctgtcctacgacgtg
ttccggtcgctgcgcggcggccagccgtggctgctgatggaacaggcgcccaacgcggtg
aactggcggccacgcaacgccgccaaggcccccggccagatgcggctgtggagctggcag
gccgtcgcccagggcgccgacggcgtgctgttcttccagtggcggcagtcggcgggcggc
gcggagaagttccactccgggatggtgccgcacgccggcaccgacacccgcaccttccgc
gaggtcaccgaactgggcgccgaactggccgccgccggggagctggcgggcacccgcccg
gacaacgacgtcgcgctcgtcctcgactgggacagctggtgggccctcgaactggactcc
cacccgtcggagctgggccaggtcgacgcgttgctcgcccactacggcccgctgttcgat
gccggcatcggatgcgacgtcgtgcaccccgaccgcgacctgtccggctaccggctcgtg
gtggtgccgaacctctacctgctgcgggagacgaccgcggcgaacctcaccgaccacgtc
cggcgcggcgggcacctgctggtgtcgttcttctccggcatcgtcgacgagaacgaccgc
gtgcacctcggcggctacccggccccgctgcgcgaggtgctgggactgcggatcccggag
ttccagccgctcgccgaaggcgccggcatcggcgtggaactgctcggcagcgccgcccgc
gcgacgctgtggtcggaaaagatcgagcccaagggtgcgagcgtgctcggcacgttcacc
gagggcgcgctcgccgggcacccggcgctgacccgccacgccttcggcgacggcgcggcc
tggtacctggcaacccgcccggagccggaggcgatgcgcacgctgatcgaccgcgtgacg
gcggaagccggtgtccaaccggtgctggcggacctgcccgccggagtgcaggcgacccgc
cgaggcgagttcttcttcctgctcaaccacaacgcggtcgaggtgaaggtgcggctgccg
tggcccgcggccgacctgctcaccggcgcacaggccgccgaggtcaccctgcccccgcgc
ggagtcgccgtcctcaagcccgtggagcggtga

DBGET integrated database retrieval system