KEGG   Saccharopolyspora erythraea: SACE_5215Help
Entry
SACE_5215         CDS       T00492                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sen00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(5828446..5829087)
Genome map
AA seq 213 aa AA seqDB search
MNEFDAQRREVIDIARRMTADGLVVGTSGNVSVRCGDLVAVTPSGVDYDDLVVDGIPLVD
LDGTVVSGSLSPTSELPMHLTAYREHDAQAVVHTHSLYATALSLLRDDVPAVHYQLADFG
GSVVVADYATFGSDRLAETMSEALEGRAGCILRNHGTVTIGKTLAQAYNRARQLEWLCQL
WLTAAQVGTPRLLDDAELASAAKRFSTYGQSSR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgagttcgacgcccagcgccgggaagtcatcgacatcgcccggaggatgaccgcc
gacggcctcgtcgtcggcacgtcgggcaacgtgtcggtccgctgcggtgacctcgtcgcg
gtgacgccatcgggcgtcgactacgacgacctcgtcgtggacggcatcccgctggtggac
ctcgacggcaccgtggtgtcgggctcgctgagcccgacctcggagctgccgatgcacctc
accgcctaccgggagcacgacgcccaggccgtggtgcacacccattccctgtacgcgacg
gcgctctccctgctgcgcgacgacgtgcccgcggtgcactaccagctcgccgacttcggc
ggcagcgtcgtggtggcggactacgcgacgttcggcagcgaccggttggccgagacgatg
tcggaggcgctcgagggccgtgccggctgcatcctgcgcaaccacggcacggtcacgatc
ggcaagaccctggcgcaggcctacaaccgggcgcggcaactggagtggctgtgccagctc
tggttgaccgcggcgcaggtgggcacgccgaggttgctggacgacgccgaactcgccagc
gcggccaagcggttctcgacctacgggcagtcctcccgctga

DBGET integrated database retrieval system