KEGG   Saccharopolyspora erythraea: SACE_5309Help
Entry
SACE_5309         CDS       T00492                                 

Gene name
cyp20
Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_5309 (cyp20)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SACE_5309 (cyp20)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACE_5309 (cyp20)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SACE_5309 (cyp20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
5939205..5940431
Genome map
AA seq 408 aa AA seqDB search
MTAGTNNAGRLGALAEAVLGYNPVDPEYHANAHEHHRRMAERGPIFRTPGGMWTAVSHAA
CSAVLRDDRFGHDPGSAAQNLFDSTQRPSVAQRSFEFMDGPDHSRLRRLVNRAFTARRVE
RLRPAVRTLADQLLTDVSGRIDVLADFILPLAMTTIVDMLGAPTEDNHLFRAWAEPIVRG
LDPDFLLSSSELAAREQANAEFAEYFDRLVALRRAEPKDDLISALIAVEDDGVVLSGNEL
ISMCLLLLAAGHESIMHLVGNGTVALLRDEDQLEHFRGHPGEVTNAVNELLRYDPPVVLL
VRTALADAEVLGNRVRRGEIVWLQIGAANRDPAVFPDPDRLDLTRDTGGSLAFGLGIHFC
IGASLARLEAAAALSALLHRDVALASEQLVHQKNVVIRGYEEVPVVLR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggcaccaacaacgccggtcgccttggtgcgttggccgaggctgttctgggc
tacaacccggtagatcccgagtaccacgccaacgcgcatgagcatcaccggcgtatggca
gagcgtggcccgatattccgcacccccggcggaatgtggaccgccgtgtcgcatgcagcg
tgctcggccgtgttgcgtgacgacagattcgggcacgaccccgggagtgcggcgcagaac
ctgttcgactcgacgcagcgtccgagcgtggcacagcgctcgttcgagttcatggacggc
ccggaccacagtcggctgcgcaggctggtcaaccgcgcgttcacggcgcgcagggttgaa
cggctgcgtccggctgtaagaacactggccgaccagctgctcacggatgtgagcggtcgg
atcgacgtactcgcggacttcatcctgccgctggcgatgaccacgatcgtggacatgttg
ggcgcgcccaccgaggacaaccatctgttccgcgcgtgggcggaaccgatcgtgcgggga
ctggacccggacttcctgctttcctcctcggagctggccgcgcgggaacaggccaacgcc
gagttcgccgagtacttcgaccgactggtggccttgcgccgggccgagccgaaggacgat
ctgatcagcgccctgatcgcggtcgaggacgacggcgtcgtcctgagcggcaacgagctg
atctcgatgtgcctgctgctgctcgccgctggacacgagtccatcatgcatctggtcggc
aacggcacagtcgccttgctgcgcgacgaggatcagctcgagcacttccgcggccacccc
ggcgaggtgacgaacgcggtgaacgagctgctgcgctacgacccacccgttgtactgctg
gtgcgtaccgcgctcgccgatgccgaggtgctcgggaaccgcgttcgccgtggcgaaatc
gtgtggctgcagatcggtgcggccaatcgggaccctgccgtttttcccgacccggaccgc
ctcgacctcaccagggacaccggtggcagcctggctttcgggctgggtattcacttctgc
atcggagcttcgctggcccggctggaggccgcggccgcgttgtccgccctgctgcaccgc
gatgtcgctctcgcctcggaacagctggtccaccagaagaacgttgtcatccgcgggtat
gaggaggtacccgtggttctgagatga

DBGET integrated database retrieval system