KEGG   Saccharopolyspora erythraea: SACE_5748Help
Entry
SACE_5748         CDS       T00492                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sen01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sen00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sen00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6460845..6461639)
Genome map
AA seq 264 aa AA seqDB search
MSLHDVFASCKQEGRAALIGYLPAGYPTVEGSKELFDAMLSGTGDEPGCDIVEVGLPFSD
PVIDGPTIQAASDRARRAGFRVRDLFDVVSSVASGGGNAAVMTYWNPVHHYGVDAFARDL
KAAGGLGVITPDLVPDEAEDWIAATDEHGIDRIFLVAPSSTEQRLAMTTKATTGFVYAAS
VMGVTGARESVGAAAEGLVKRTRAYTDLPIGVGLGVRSGEHAAQVAGFADGVIVGSAFVD
RAEREGVEGVRALASELARGVRAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctccacgacgttttcgcttcctgcaagcaggaggggcgcgcggcgctcatcggc
tacctcccggccggttacccgaccgtggagggctcgaaggagctgttcgacgcgatgctg
tcgggcaccggtgacgagccgggctgcgacatcgtcgaggtcggcctgccgttctccgac
ccggtgatcgacggcccgaccatccaggccgccagcgaccgggcgcggcgcgccggcttc
cgggtgcgcgacctgttcgacgtcgtttcctcggtcgcctccggcggcggcaacgccgcg
gtgatgacctactggaacccggtgcaccactacggcgtggacgccttcgcccgcgacctc
aaggccgcgggcgggctcggggtcatcaccccggacctggtgccggacgaggccgaggac
tggatcgcggccaccgacgagcacggcatcgaccggatcttcctggtggcgccgtcgtcg
accgagcagcggctggcgatgaccaccaaggcgaccaccgggttcgtctacgcggcctcg
gtgatgggcgtgacgggcgcgcgcgagtccgtcggcgccgcggcggaggggctggtcaag
cgcacccgcgcctacaccgacctgccgatcggcgtcggtctgggcgtgcgctcgggcgag
cacgccgcgcaggtcgccggcttcgccgacggcgtcatcgtcggctcggcgttcgtcgac
cgcgccgagcgagagggcgtcgagggcgtgcgggcactggcctcggagctggccaggggc
gttcgcgcccgctga

DBGET integrated database retrieval system