KEGG   Saccharopolyspora erythraea: SACE_5748Help
Entry
SACE_5748         CDS       T00492                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACE_5748 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_5748 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACE_5748 (trpA)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SACE_5748 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6460845..6461639)
Genome map
AA seq 264 aa AA seqDB search
MSLHDVFASCKQEGRAALIGYLPAGYPTVEGSKELFDAMLSGTGDEPGCDIVEVGLPFSD
PVIDGPTIQAASDRARRAGFRVRDLFDVVSSVASGGGNAAVMTYWNPVHHYGVDAFARDL
KAAGGLGVITPDLVPDEAEDWIAATDEHGIDRIFLVAPSSTEQRLAMTTKATTGFVYAAS
VMGVTGARESVGAAAEGLVKRTRAYTDLPIGVGLGVRSGEHAAQVAGFADGVIVGSAFVD
RAEREGVEGVRALASELARGVRAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctccacgacgttttcgcttcctgcaagcaggaggggcgcgcggcgctcatcggc
tacctcccggccggttacccgaccgtggagggctcgaaggagctgttcgacgcgatgctg
tcgggcaccggtgacgagccgggctgcgacatcgtcgaggtcggcctgccgttctccgac
ccggtgatcgacggcccgaccatccaggccgccagcgaccgggcgcggcgcgccggcttc
cgggtgcgcgacctgttcgacgtcgtttcctcggtcgcctccggcggcggcaacgccgcg
gtgatgacctactggaacccggtgcaccactacggcgtggacgccttcgcccgcgacctc
aaggccgcgggcgggctcggggtcatcaccccggacctggtgccggacgaggccgaggac
tggatcgcggccaccgacgagcacggcatcgaccggatcttcctggtggcgccgtcgtcg
accgagcagcggctggcgatgaccaccaaggcgaccaccgggttcgtctacgcggcctcg
gtgatgggcgtgacgggcgcgcgcgagtccgtcggcgccgcggcggaggggctggtcaag
cgcacccgcgcctacaccgacctgccgatcggcgtcggtctgggcgtgcgctcgggcgag
cacgccgcgcaggtcgccggcttcgccgacggcgtcatcgtcggctcggcgttcgtcgac
cgcgccgagcgagagggcgtcgagggcgtgcgggcactggcctcggagctggccaggggc
gttcgcgcccgctga

DBGET integrated database retrieval system