KEGG   Saccharopolyspora erythraea: SACE_5748Help
Entry
SACE_5748         CDS       T00492                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00260  Glycine, serine and threonine metabolism
sen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01130  Biosynthesis of antibiotics
sen01230  Biosynthesis of amino acids
Module
sen_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_5748 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACE_5748 (trpA)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SACE_5748 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAM04933
Cambridge: SACE_5748
Kitasato: SACE_5748
UniProt: A4FLK8
Position
complement(6460845..6461639)
Genome map
AA seq 264 aa AA seqDB search
MSLHDVFASCKQEGRAALIGYLPAGYPTVEGSKELFDAMLSGTGDEPGCDIVEVGLPFSD
PVIDGPTIQAASDRARRAGFRVRDLFDVVSSVASGGGNAAVMTYWNPVHHYGVDAFARDL
KAAGGLGVITPDLVPDEAEDWIAATDEHGIDRIFLVAPSSTEQRLAMTTKATTGFVYAAS
VMGVTGARESVGAAAEGLVKRTRAYTDLPIGVGLGVRSGEHAAQVAGFADGVIVGSAFVD
RAEREGVEGVRALASELARGVRAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctccacgacgttttcgcttcctgcaagcaggaggggcgcgcggcgctcatcggc
tacctcccggccggttacccgaccgtggagggctcgaaggagctgttcgacgcgatgctg
tcgggcaccggtgacgagccgggctgcgacatcgtcgaggtcggcctgccgttctccgac
ccggtgatcgacggcccgaccatccaggccgccagcgaccgggcgcggcgcgccggcttc
cgggtgcgcgacctgttcgacgtcgtttcctcggtcgcctccggcggcggcaacgccgcg
gtgatgacctactggaacccggtgcaccactacggcgtggacgccttcgcccgcgacctc
aaggccgcgggcgggctcggggtcatcaccccggacctggtgccggacgaggccgaggac
tggatcgcggccaccgacgagcacggcatcgaccggatcttcctggtggcgccgtcgtcg
accgagcagcggctggcgatgaccaccaaggcgaccaccgggttcgtctacgcggcctcg
gtgatgggcgtgacgggcgcgcgcgagtccgtcggcgccgcggcggaggggctggtcaag
cgcacccgcgcctacaccgacctgccgatcggcgtcggtctgggcgtgcgctcgggcgag
cacgccgcgcaggtcgccggcttcgccgacggcgtcatcgtcggctcggcgttcgtcgac
cgcgccgagcgagagggcgtcgagggcgtgcgggcactggcctcggagctggccaggggc
gttcgcgcccgctga

DBGET integrated database retrieval system