KEGG   Saccharopolyspora erythraea: SACE_5749Help
Entry
SACE_5749         CDS       T00492                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACE_5749 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_5749 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACE_5749 (trpB)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SACE_5749 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6461636..6462913)
Genome map
AA seq 425 aa AA seqDB search
MTPASGADTAHAHRPGKPVPEGHDPDERGHFGPYGGRFMPEALIAAQDELAAEYEKAQHD
PEYVDELARLLRDYAGRPSLLTEAERFSEHAGGARILLKREDLNHTGSHKINNVLGQALL
VKRMGKHRVIAETGAGQHGVATATACALLGLECVIYMGEVDTKRQALNVARMRLLGAEVI
PVAAGSATLKDAINEALRDWVTNVEDTHYLLGTAAGAHPFPVMVRNFHRVIGEEAREQAL
ALTGRLPDVVAACVGGGSNAIGIFHGFIDDPDVRLVGFEPAGHGLDSGEHGATLTQGTPG
TLHGARSYLLQDDDGQITEAYSISAGLDYPGVGPEHSYLKDSGRAEYRAVTDDEAMQAFQ
LLSRTEGIIPAIESAHALAGAIELGKELGPEAVILVSLSGRGDKDMDTAAKYFGLVDEAE
QEKAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcaagcggcgcggacaccgcgcacgcccaccgcccgggcaaacccgtgccg
gaaggccacgacccggacgagcgcgggcacttcggaccctacggcggccggttcatgccg
gaggcgctgatcgccgcccaggacgagctggccgccgagtacgagaaggcccagcacgac
ccggagtacgtcgacgagctggcccgcctgctgcgcgactacgcggggcggccctcgctg
ctgaccgaggccgagcgcttctccgagcacgcgggcggcgcgcggatcctgctcaagcgc
gaggacctcaaccacaccggctcgcacaagatcaacaacgtgctcgggcaggcgctgctg
gtcaagcggatgggcaagcaccgggtgatcgccgagaccggtgccggccagcacggcgtc
gccacggcgaccgcgtgcgcgctgctcggcctcgaatgcgtcatctacatgggcgaggtc
gacaccaagcgccaggcgctcaacgtggcccggatgcggctgctcggcgccgaggtcatc
ccggtcgccgccggttcggccaccctcaaggacgcgatcaacgaggcgctgcgcgactgg
gtcaccaacgtcgaggacacccactacctgctgggcaccgcggccggcgcgcacccgttc
ccggtcatggtccgcaacttccaccgggtcatcggcgaggaggcccgcgagcaggcgctg
gcgctgaccggcaggctgcccgacgtcgtcgccgcgtgcgtgggcggcggctccaacgcc
atcggcatcttccacggcttcatcgacgacccggacgtgcggctggtcgggttcgagccc
gcgggccacggcctggacagcggcgagcacggcgcgaccctgacccagggcacccccggg
acgctgcacggagcgcgctcgtacctgctgcaggacgacgacggccagatcaccgaggcg
tactcgatctcggcgggcctggactaccccggcgtcgggccggagcactcctacctcaag
gactccggccgcgccgagtaccgcgcggtcaccgacgacgaggcgatgcaggccttccag
ctgctctcgcgcaccgagggcatcatcccggcgatcgagtccgcgcacgccctggccggc
gcgatcgagctcggcaaggagctcggcccggaggcggtcatcctggtgagcctgtccggt
cgcggcgacaaggacatggacaccgccgcgaagtacttcggcctcgtcgacgaggcggaa
caggagaaggcccggtga

DBGET integrated database retrieval system