KEGG   Saccharopolyspora erythraea: SACE_5750Help
Entry
SACE_5750         CDS       T00492                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01130  Biosynthesis of antibiotics
sen01230  Biosynthesis of amino acids
Module
sen_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACE_5750 (trpC)
Enzymes [BR:sen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SACE_5750 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase DUF3509 NanE
Motif
Other DBs
NCBI-ProteinID: CAM04935
Cambridge: SACE_5750
Kitasato: SACE_5750
UniProt: A4FLL0
Position
complement(6463032..6463841)
Genome map
AA seq 269 aa AA seqDB search
MSVLESIIDGVREDLAVRESTIPFDEIKQRSAAAPPPRDVMAALHAPGVGVIAEVKRRSP
SKGELADIAEPAELAADYAAAGARVISVLTEQRRFGGSLADFDAVRAKVSAPLLRKDFIV
SPYQVHEARAHGADMVLLIVAALEQVALEALLDRVESLGMTALVEVHTAEEADRALEAGA
KVIGINARNLHTLEVDRDVFGRIAPGLPVEVLKVAESGVRGPSDLMAYAGSGADAVLVGE
GLVTSDNPRTAVTQLVTAGSHPACPRPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttctggaatccatcatcgacggtgttcgcgaggacctggccgtccgggaatcg
acgattcccttcgacgagatcaagcagcggtccgcggcggctccaccgccgagggacgtc
atggccgcgctgcacgccccgggcgtgggcgtgatcgccgaggtcaagcggcgcagcccg
tccaagggcgagctcgccgacatagccgagcccgccgagctggcggccgactacgccgcg
gccggggcgcgcgtgatcagcgtgctcaccgagcagcgccgcttcggcggctcgctggcc
gacttcgacgcggtgcgcgccaaggtgagcgcgccgctgctgcgcaaggacttcatcgtc
agcccctaccaggtgcacgaggcccgcgcgcacggcgcggacatggtgctgctgatcgtg
gccgcgctggagcaggtggcgctggaggcgctgctggaccgggtcgagtcgctgggcatg
acggcgctggtcgaggtgcacaccgccgaggaggccgaccgcgcgctggaggccggtgcc
aaggtcatcggcatcaacgcccgcaacctgcacaccctggaggtggaccgggacgtcttc
ggccggatcgcccccgggctgccggtcgaggtgctcaaggtcgctgaatcgggtgttcgt
ggcccgagcgacctgatggcctacgccggttcgggcgccgacgcggtgctcgtcggggag
gggctggtcaccagcgacaacccgcgcacggcggtgacgcagctggtcaccgcgggttcc
cacccggcctgcccgcgccccagcaggtga

DBGET integrated database retrieval system