KEGG   Saccharopolyspora erythraea: SACE_5778Help
Entry
SACE_5778         CDS       T00492                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00340  Histidine metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01230  Biosynthesis of amino acids
Module
sen_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SACE_5778 (hisD)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SACE_5778 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAM04963
Cambridge: SACE_5778
Kitasato: SACE_5778
UniProt: A4FLN8
Position
complement(6489023..6490339)
Genome map
AA seq 438 aa AA seqDB search
MLTRTDLRGRVPSNAELRATLPRAEMDVEHVLHQVRPVIESVRDDGVRAVLDHTEKFDRV
RPERVRVGADELRRALDELDPAVRSALEESIARARKVHADQRRTDTTTRVAPGGTVTERW
VPVARVGLYAPGGLAVYPSSVVMNVVPAQAAGVESLVVCSPPQAEFGGLPHPTILAAAEL
LGVDEVWAVGGAQAVALLAYGAEDTDGAALEPADMVTGPGNVYVTAAKRHLRSLIGIDSE
AGPTEIAVLADDTADPVHVAADLISQAEHDTLAASVLVTTSERLADAVDAELARQVPLTK
HTERIRTALTSVQSGCILVAGIADGIRVVDAYAAEHLEIQTADADAVAARVRNAGAIFVG
PYAPVSLGDYCAGSNHVLPTGGCARHSSGLSVQSFLRGIHVISYTEQALRDVAGQVVALA
DAEDLPAHGQAVTARFPD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcacccgtaccgacctgcgcggtcgtgttccgtccaacgccgagctgcgggcgacg
ctgccccgcgccgagatggacgtcgagcacgttctgcatcaggtgcggccggtgatcgag
agcgtccgcgacgacggcgtgcgagccgtcctcgaccacaccgagaagttcgatcgggta
cgacccgaacgggtgagggtgggggccgatgagctgcggcgcgccctcgacgagctcgac
cccgcggtgcgctcggcgctggaggagtccatcgcccgggcccgcaaggtccacgccgac
cagcgccgcaccgacaccaccacccgggtcgcgcccggcggcaccgtcaccgagcggtgg
gtgccggtggcccgcgtcggcctctacgcaccgggcggcctggcggtctacccctccagc
gtggtgatgaacgtcgtgcccgcgcaggccgcgggcgtggagtcgctggtggtgtgctct
ccgccgcaggcggagttcggcgggctgccgcacccgacgatcctggccgccgccgagctg
ctgggcgtcgacgaggtgtgggcggtcggcggcgcgcaggcggtggcgctgctcgcctac
ggcgccgaggacaccgacggcgcggcccttgagccggccgacatggtcaccggacccggc
aacgtctacgtcacggcggccaagcgccacctgcgcagcctgatcggcatcgactccgag
gcaggccccaccgagatcgcggtgctggccgacgacaccgccgacccggtgcacgtcgcc
gccgacctgatcagccaggccgagcacgacacgctggcggccagcgtgctggtgaccacc
tccgagcggctggccgacgccgtcgacgccgaactggccaggcaggtgccgctgaccaag
cacaccgagcgcatccgcaccgcgctgaccagcgtgcagtccggttgcatcctggtggcc
ggcatcgccgacggcatccgcgtcgtcgacgcctacgccgccgagcacctggagatccag
accgccgacgccgacgccgtggccgcccgggtccgcaacgctggcgcgatcttcgtcggc
ccgtacgcgccggtgtcgctgggcgactactgcgcgggctccaaccacgtgctgcccacc
ggcggctgcgcccggcactcgtcggggctgagcgtgcagagcttcctgcgcggcatccac
gtgatctcctacaccgagcaggcgctgcgcgacgtggcgggccaggtcgtcgcgcttgcc
gacgccgaggacctgcccgcgcacggccaggccgtgaccgcccgcttcccggactga

DBGET integrated database retrieval system