KEGG   Saccharopolyspora erythraea: SACE_5965Help
Entry
SACE_5965         CDS       T00492                                 

Gene name
chlI
Definition
magnesium-chelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sen00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6696206..6698356)
Genome map
AA seq 716 aa AA seqDB search
MTAVRYPFSAVVGHDDLRLALLLNAVHPRIGGVLVRGEKGTAKSTIVRALAALLPELDVV
PDCRFGCAPLDADPRCPDGPHDGTASSVRPAQLVELPVGATEDRLVGSLDLERALTDGVR
AYQPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAAMGRAHVEREGVSVTHAASFLLVGT
MNPEEGELRPQLLDRFGLTVHVTASRDVPTRTEVVRRRLAFEADPAGFARRWEDEDADLA
KRIAAARERVGSVVLPDSELRRISALCAAFEVDGMRGDLVLARTAVAHAAWRGAESVAEA
DVEAAARLALPHRRRRDPFDEPGVEEEQLQQALSDAAEHADNPPEGEHDGQPGDEHDEQS
GDDRDGRSDDGPDEGGPDGAADPDDGPDGPDGPDGGPDGNGPDGDGPDGGPGGGQAAPEE
CGEPRRKAPSERPPAPPAAAFRARLLEVPGVGEGAPGRRSRSRSRTGRAVRASTVDGHGI
HLPATLSAAAPHQSARGRSGPGLLLRRHDVRHAVREGREGNLVLFVVDASGSMAARERMS
AVSGAVLSLLRDAYQRRDKVGVVTFRGDSAEVALPPTSSVDTAAVRMRRLRTGGRTPLAD
GLLKANKVVGTERTRDPRRRPLLVLLTDGKATVPLKSDVDGRARRAVDDALRAAGLLADA
GVASVVVDCENGMVRLGLADRLAGALSAPCLRLEELSADNVAGVVRAVRDGGSRAA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtgcgctacccgttctccgccgtggtcggacacgacgacctgcggctggcc
ctgctgctcaacgcggtgcacccgcgcatcggcggggtcctggtccgcggcgagaagggc
accgccaagtcgaccatcgtgcgcgccctggccgcgctgctgcccgagctggacgtggtg
cccgactgccgcttcggctgcgcaccgctggacgccgacccgcgctgccccgacggcccg
cacgacggcaccgcctcgtcggtccgccccgcgcagctcgtggagctcccggtcggcgcg
accgaggaccgcctggtcggctcgctcgacctggagcgcgccctcaccgacggcgtccgc
gcctaccagcccggtctgctcgcggccgcccaccgcggcgtcctgtacgtcgacgaggtg
aacctgctgcacgaccacctcgtcgacctgctgctcgacgccgccgcgatgggacgcgcg
cacgtcgagcgcgagggcgtctcggtgacccacgccgcctcgttcctgctcgtcggcacg
atgaaccccgaggagggcgagctgcggccgcagctgctcgaccggttcggcctcacggtc
cacgtcacggcctcccgcgacgtgccgacgcggaccgaggtggtgcggcggcggctggcg
ttcgaggccgacccggcgggtttcgcccgccgttgggaggacgaggacgccgacctggcc
aagcggatcgcggccgcccgggaacgggtcggctcggtggtgctgccggactccgagctg
cggcggatctccgcgctgtgcgcggccttcgaggtcgacggcatgcgcggtgacctcgtg
ctcgcccggacggcggtggcgcacgcggcctggcgcggcgcggagtcggtggccgaggcc
gacgtcgaggcggccgcccgcctcgcgctgccgcaccgcaggcgccgcgacccgttcgac
gagcccggggtggaggaggagcagttgcagcaggcgctctccgacgccgccgagcacgcg
gacaacccgccggaaggggagcacgacgggcaacccggcgacgagcacgacgagcagtcc
ggcgacgaccgcgacggacgatccgacgacggccccgacgaaggcggcccggacggcgcg
gccgatcccgacgacggaccggacggccccgacggtcccgatggcggccccgacgggaac
ggtcctgacggcgacggcccggacggcgggccgggtggcggtcaagccgccccggaggag
tgcggcgaaccgcgccgcaaggccccgtcggagcgtccgcccgcgccgcccgcggcggcg
ttccgggctcggctgctggaagtgccgggcgtcggcgagggcgcgcccggcaggcgctcc
cgctcgcggtcgcgcaccggccgcgccgtacgcgcttccacagtggacggacacggcatc
cacctgcccgccacgctgagcgccgcggcgccccaccagtccgcgcgcggacgcagcggt
cccgggctgctgctccgccgccacgacgtgcggcacgccgttcgcgaaggcagggaaggc
aacctggtgctgttcgtggtcgacgcgtcgggttcgatggcggcccgcgaacggatgtcg
gcggtcagcggtgccgtgctctccctgctgcgcgacgcctaccagcgacgggacaaggtc
ggggtggtgaccttccgcggcgactccgccgaggtggcgctgccgcccacgtcctctgtg
gacaccgccgcggtccggatgcgcaggttgcgcaccggcgggcgcacgccgctcgccgac
ggactgctcaaggcgaacaaggtcgtcggcaccgagcgcacgcgcgacccgcgccgccgt
ccgctgctggtgctgctcaccgacggcaaggcgacggtcccgctgaagtccgatgtggac
ggacgggcgcgccgtgcggtcgacgacgcgttgcgcgcggcagggctgctcgccgacgcc
ggcgtcgcatcggtcgtcgtcgactgcgagaacgggatggtgcggctggggctcgccgac
cggctcgccggtgcgctctcggcgccgtgcctgcggctggaagaactgtcggccgacaac
gtcgccggtgtcgtgcgcgccgtgcgggatggcggttcgcgcgcggcttga

DBGET integrated database retrieval system