KEGG   Saccharopolyspora erythraea: SACE_6017Help
Entry
SACE_6017         CDS       T00492                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sen00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6752602..6753543)
Genome map
AA seq 313 aa AA seqDB search
MNDPIGPVDATRVPRYGGDTTFARLPRLADVTDADALVWGVPFDTGVSYRPGARFGPNHV
RQSSRLLRPYNPALDAMPFGRRQVADAGDLGVNPFDIGEAIATVENGARELSGTSRTLIT
VGGDHTIALPLLRVQHERHGPVAVLHFDAHLDTWDTYFGAPHTHGTPFRRAAEEGLIDFD
HSMHVGIRGPLYSKLDLDESEKMGFAAVHCRDFARSPLDDIINRIRTRLGSRPVYVSVDI
DVLDPGFAPGTGTPEAGGLSSRELLEVLRGLDGLDVVGADLVEVAPAYDHAEITGIAAAH
VVYEMLSILPGGR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacccgatcggcccggtggacgccacccgcgtcccccgctacggcggcgacacc
accttcgcccgcctgcccaggctggccgacgtgaccgacgccgacgcgctggtgtggggc
gtgccgttcgacaccggcgtcagctaccggccgggcgcgcggttcggccccaaccacgtg
cggcagagctcgcgcctgctgcgcccgtacaacccggcgctggacgccatgcccttcggc
cgcaggcaggtcgccgacgccggtgacctgggcgtcaacccgttcgacatcggcgaggcc
atcgccaccgtggagaacggggcccgcgagctgtccgggaccagccggacgctgatcacg
gtgggcggcgaccacaccatcgcgctgccgctgctgcgcgtgcagcacgaacggcacggg
ccggtcgcggtgctgcacttcgacgcgcacctggatacctgggacacctacttcggcgct
ccccacacgcacggcacgccgttccgccgcgcggccgaggaagggctcatcgacttcgac
cactcgatgcacgtcggcatccggggtccgctgtactccaagctcgacctcgacgagagc
gagaagatgggcttcgccgcggtgcactgccgcgacttcgcccgctcgccgctggacgac
atcatcaaccggatccgcacccggctcggttcccggccggtgtacgtgtcggtggacatc
gacgtcctcgaccccggtttcgcgccgggcaccggcacgccggaggcgggcggtctgtcc
agccgcgagctgctggaggtcctgcgcgggctcgacggcctcgacgtcgtcggcgccgac
ctggtcgaggtcgcgcccgcctacgaccacgccgagatcaccggtatcgccgcggcgcac
gtcgtgtacgaaatgctgagcatcctgcctggaggccgctga

DBGET integrated database retrieval system