KEGG   Saccharopolyspora erythraea: SACE_6017Help
Entry
SACE_6017         CDS       T00492                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SACE_6017 (speB)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SACE_6017 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6752602..6753543)
Genome map
AA seq 313 aa AA seqDB search
MNDPIGPVDATRVPRYGGDTTFARLPRLADVTDADALVWGVPFDTGVSYRPGARFGPNHV
RQSSRLLRPYNPALDAMPFGRRQVADAGDLGVNPFDIGEAIATVENGARELSGTSRTLIT
VGGDHTIALPLLRVQHERHGPVAVLHFDAHLDTWDTYFGAPHTHGTPFRRAAEEGLIDFD
HSMHVGIRGPLYSKLDLDESEKMGFAAVHCRDFARSPLDDIINRIRTRLGSRPVYVSVDI
DVLDPGFAPGTGTPEAGGLSSRELLEVLRGLDGLDVVGADLVEVAPAYDHAEITGIAAAH
VVYEMLSILPGGR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacccgatcggcccggtggacgccacccgcgtcccccgctacggcggcgacacc
accttcgcccgcctgcccaggctggccgacgtgaccgacgccgacgcgctggtgtggggc
gtgccgttcgacaccggcgtcagctaccggccgggcgcgcggttcggccccaaccacgtg
cggcagagctcgcgcctgctgcgcccgtacaacccggcgctggacgccatgcccttcggc
cgcaggcaggtcgccgacgccggtgacctgggcgtcaacccgttcgacatcggcgaggcc
atcgccaccgtggagaacggggcccgcgagctgtccgggaccagccggacgctgatcacg
gtgggcggcgaccacaccatcgcgctgccgctgctgcgcgtgcagcacgaacggcacggg
ccggtcgcggtgctgcacttcgacgcgcacctggatacctgggacacctacttcggcgct
ccccacacgcacggcacgccgttccgccgcgcggccgaggaagggctcatcgacttcgac
cactcgatgcacgtcggcatccggggtccgctgtactccaagctcgacctcgacgagagc
gagaagatgggcttcgccgcggtgcactgccgcgacttcgcccgctcgccgctggacgac
atcatcaaccggatccgcacccggctcggttcccggccggtgtacgtgtcggtggacatc
gacgtcctcgaccccggtttcgcgccgggcaccggcacgccggaggcgggcggtctgtcc
agccgcgagctgctggaggtcctgcgcgggctcgacggcctcgacgtcgtcggcgccgac
ctggtcgaggtcgcgcccgcctacgaccacgccgagatcaccggtatcgccgcggcgcac
gtcgtgtacgaaatgctgagcatcctgcctggaggccgctga

DBGET integrated database retrieval system