KEGG   Saccharopolyspora erythraea: SACE_6091Help
Entry
SACE_6091         CDS       T00492                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SACE_6091
Enzymes [BR:sen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SACE_6091
Peptidases [BR:sen01002]
 Cysteine Peptidases
  Family C44
   SACE_6091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
6831939..6833765
Genome map
AA seq 608 aa AA seqDB search
MCGISGWIDYQRDLTRERPVIDAMCRTMACRGPDAAGTWVRPHASLGHRRLAIIDLPGGA
QPMEADTPDGPVAMVYSGEAYNFTELRDELRRRGHRFTTDSDTEVVLRGYLEWGAEVAEH
LNGMYAFAIWDSRTEKLLLIRDRMGVKPLYYYPTEHGVLFGSEPKAILANPLAEKVVDAD
GMRELFSMTKTPGQAVWAGMREVQPGTVVTVDRTGLREHTYWRLTAVEHTDDRDASVARV
RELLDDIVARQLISDVPRCVLLSGGLDSSAITALAARQLSGRGEQVRSFAVDFLGQTENF
VPDPMRDTPDGPFVHDVAEHVDSLHQDIVLDPATLADPAVRRAAVAARDMPMGLGDLDQS
LYLLFKAIRGHSTVALSGESADEVFGGYRWFHDPQVQQADTFPWLAGAPGSTGGMLAPEL
RNKLDLDAFVADSYRSAVAEAPVLQGESEFERRMRLMCYLHLTRFVRILLDRKDRMSMAV
GLEVRVPFCDHRLVEYVFNAPWSLKTFDGREKSLLRQATADALPRSVVERTKSPYPSTQD
PEYGVELFGQVSDVVRRQDPALSIVDEQAVRQIMAAGPDAVDTPTRFFLERVLDLSVWFD
LHQPTVKV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatctccggctggatcgactaccaacgcgatctgacccgcgaacgacccgtc
atcgacgcgatgtgccggaccatggcctgccgtggcccggacgccgcggggacctgggtt
cgtccgcacgcctccctcggccaccgcaggctggcgatcatcgacctccccggcggcgcg
cagccgatggaggccgacacccccgacgggccggtcgccatggtttacagcggcgaggcc
tacaacttcaccgagctgcgcgacgagctgcgccgcaggggccaccgcttcacgaccgac
agcgacaccgaggtcgtgttgcgcggctacctggagtggggcgcggaggtcgccgagcac
ctcaacggcatgtacgccttcgccatctgggactcgcgcaccgagaagctgctgctcatc
cgggaccggatgggcgtgaagccgctctactactaccccaccgagcacggcgtgctcttc
ggctccgagcccaaggcgatcctggccaacccgctggccgagaaggtcgtcgacgccgac
ggcatgcgcgagctgttcagcatgaccaagacgccgggccaggcggtctgggcgggcatg
cgcgaggtccagcccggcaccgtggtgaccgtcgaccggaccggcctgcgcgagcacacc
tactggcggctcaccgcggtcgagcacaccgacgaccgcgacgccagcgtcgcacgcgtg
cgcgagctgctcgacgacatcgtggcccgccagctcatctccgacgtgccgcgctgcgtg
ctgctctccggcggcctggactccagcgccatcaccgcgctggccgcccggcagctcagc
gggcggggcgagcaggtccgcagcttcgcggtggacttcctcggccagaccgagaacttc
gtgcccgacccgatgcgcgacacccccgacgggccgttcgtgcacgacgtcgccgagcac
gtcgactcgctccaccaggacatcgtgctcgacccggcgacgcttgccgaccccgccgtg
cgccgcgccgcggtggccgcccgcgacatgccgatgggcctgggcgacctcgaccagtcg
ctgtacctgctgttcaaggcgatccgcgggcactcgacggtggcgctgtcgggggagtcg
gccgacgaggtgttcggcggctaccggtggttccacgacccgcaggtgcagcaggccgac
accttcccgtggctcgcgggcgcgcccggcagcacgggcgggatgctcgcaccggagctg
cgcaacaagttggacctggacgccttcgtcgccgacagctaccggtccgcggtcgccgaa
gccccagtgctgcaaggggagagcgagttcgagcgccggatgcggctgatgtgctacctg
cacctgacgcggttcgtgcgcatactgctcgaccgcaaggaccggatgagcatggcggtc
ggcctggaggtgcgggtgccgttctgcgaccaccggctcgtcgagtacgtcttcaacgcg
ccgtggtcgctgaagaccttcgacggcagggagaagagcctgctgcgccaggcgaccgcc
gacgcgctgccgcgttcggtggtcgagcggaccaagagcccgtatccgtccacgcaggac
ccggagtacggcgtggagctgttcggtcaggtgtccgacgtggtccgcaggcaggacccg
gcgctgtcgatcgtcgacgagcaggccgtgcgccagatcatggccgcagggccggacgcg
gtcgacaccccgacgcggttcttcctcgaacgggtgctcgacctgtcggtctggttcgac
ctgcaccagccgacggtcaaggtctag

DBGET integrated database retrieval system