KEGG   Saccharopolyspora erythraea: SACE_6105Help
Entry
SACE_6105         CDS       T00492                                 

Definition
guanine-specific ribonuclease N1 and T1 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
sen  Saccharopolyspora erythraea
Brite
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     SACE_6105
Transfer RNA biogenesis [BR:sen03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    SACE_6105
 Prokaryotic Type
    SACE_6105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6847561..6847998)
Genome map
AA seq 145 aa AA seqDB search
MRRITKSNAVRTLLAGLIAVVGLLGFQAGAVQALPVAPQAPAAAQAPCGDTSGFEQVRLA
DLPPEATDTYELIQKGGPYPYPQDGTVFQNREGILPDCAEGYYHEYTVKTPGSDDRGARR
FVVGDGGEYFYTEDHYESFRLTIVN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggatcacgaagtcgaacgcagtcaggaccctgctggccggtctgatcgccgtg
gtgggtctgctcgggttccaggccggggccgtgcaggccctgccggtcgccccgcaggcg
cccgccgccgcgcaggcaccgtgtggcgacacctccggattcgagcaggtcaggctggcc
gacctgcccccggaggccaccgacacctacgagctgatccaaaagggcggcccgtacccc
tacccgcaggacggcacggtcttccagaaccgcgagggcatcctgccggactgcgccgag
ggctactaccacgagtacaccgtgaagacccccggcagcgacgaccgcggcgcccgccgc
ttcgtcgtcggtgacggcggcgagtacttctacaccgaggaccactacgagtccttccgc
ctgaccatcgtcaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system