KEGG   Saccharopolyspora erythraea: SACE_6199Help
Entry
SACE_6199         CDS       T00492                                 

Definition
(GenBank) glycoside hydrolase, family 57
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00500  Starch and sucrose metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6199
Enzymes [BR:sen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SACE_6199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957
Motif
Other DBs
NCBI-ProteinID: CAM05372
Cambridge: SACE_6199
Kitasato: SACE_6199
UniProt: A4FMU7
Position
6946907..6948388
Genome map
AA seq 493 aa AA seqDB search
MGDFAMVLHSHLPWLAGHGRWPVGEEWLYQAWASSYLPVVGMLERLAAEGHRDVLTFGLT
PVLAAQLDDPHCLRGFHHWLGNWRLRAEEAAARWRGSGDELAAAECRAASRALEEFELRW
RHGASPVLRPLVDSDVVELIGGPATHPFQPLLDPRLREFALRLGLADTRLRLGSAPEGIW
APECAYGPGVEREYAATGVRRFLVDGSALDDVSAAHTVGRTDIVCFGRDVSISDLVWSDG
GYPSHPAYRDFHTFDHAVGLKPSRITGKDVAPEDKQPYALGPAAAVADEHADDFVAAVRQ
RLEEHRERGGRQGLVVAAFDTELFGHWWFEGPRWLERVLRTLPEAGVRVTTLRGALAVGH
LGEPVELPETSWGVGGDWRVWAGEPVAEIADANQRLQERVLRRAPRAGAARDHVLDQLLR
ETVLALASDWAFMVTHDAGAGYARERAHDHTSRAHRLLDLLESGRYADADALARELRGRD
GVFGHLDARLLPG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacttcgccatggtcctgcacagccacctgccctggctcgccgggcacggccgg
tggccggtcggcgaggagtggctctaccaggcgtgggcctcctcctacctgcccgtggtg
gggatgctggagcggctggccgccgagggccaccgcgacgtgctcaccttcggcctcacc
ccggtgctggccgcgcagctcgacgacccgcactgccttcgcggcttccaccactggctg
ggcaactggcggctgcgcgccgaggaggccgcggcgcgctggcgcggctcgggcgacgag
ctggccgccgccgagtgccgcgcggcctcgcgagcgctggaggagttcgagctgcggtgg
cgccacggcgcgtcgccggtgctgcggccgctggtcgactcggacgtggtcgagctgatc
ggcgggcccgccacgcacccgttccagccgctgctcgacccgcggctgcgcgagttcgcg
ctccggctcgggctggccgacacccggctgcgcctgggcagcgcgccggagggcatctgg
gctccggagtgcgcctacggcccgggcgtggagcgcgagtacgccgcgacgggcgtgcgg
cgcttcctggtcgacggcagcgcgctggacgacgtctccgccgcgcacaccgtcggccgc
accgacatcgtgtgcttcgggcgggacgtgtcgatcagcgacctggtgtggtccgacggc
ggctacccctcgcacccggcctaccgcgacttccacaccttcgaccacgccgtgggcctc
aagccgtcgcgcatcaccggcaaggacgtcgcgccggaggacaagcagccctacgcgctc
ggcccggcggcggcggtggccgacgagcacgccgacgacttcgtggccgccgtgcggcag
cgactggaggagcaccgcgaacgcggcggccgccagggactcgtggtcgcggccttcgac
accgagctgttcgggcactggtggttcgagggtccgcgctggctggaacgggtgttgcgc
acgctgcccgaggccggtgtccgggtgacgacgctgcgcggcgcgctggccgtcggccac
ctgggcgagccggtcgagctgccggagacctcgtggggcgtcgggggtgactggcgcgtg
tgggcgggtgagccggtcgccgagatcgccgacgcgaaccagcggctccaggaacgcgtg
ctgcgccgggcaccgcgggcgggcgccgcccgcgaccacgtcctcgaccagctcctgcgc
gagaccgtgctcgcgctggccagcgactgggcgttcatggtcacccacgacgcgggagcg
ggctacgcccgcgagcgcgcccacgaccacacctcgcgcgcccaccggctgctcgacctg
ctggagtcgggacggtacgccgacgccgacgcgctggcccgcgagctgcgcgggcgcgac
ggcgtgttcggccacctcgacgcccggctgctgcccggctga

DBGET integrated database retrieval system