KEGG   Saccharopolyspora erythraea: SACE_6199Help
Entry
SACE_6199         CDS       T00492                                 

Definition
glycoside hydrolase
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sen  Saccharopolyspora erythraea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6199
Enzymes [BR:sen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SACE_6199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
6946907..6948388
Genome map
AA seq 493 aa AA seqDB search
MGDFAMVLHSHLPWLAGHGRWPVGEEWLYQAWASSYLPVVGMLERLAAEGHRDVLTFGLT
PVLAAQLDDPHCLRGFHHWLGNWRLRAEEAAARWRGSGDELAAAECRAASRALEEFELRW
RHGASPVLRPLVDSDVVELIGGPATHPFQPLLDPRLREFALRLGLADTRLRLGSAPEGIW
APECAYGPGVEREYAATGVRRFLVDGSALDDVSAAHTVGRTDIVCFGRDVSISDLVWSDG
GYPSHPAYRDFHTFDHAVGLKPSRITGKDVAPEDKQPYALGPAAAVADEHADDFVAAVRQ
RLEEHRERGGRQGLVVAAFDTELFGHWWFEGPRWLERVLRTLPEAGVRVTTLRGALAVGH
LGEPVELPETSWGVGGDWRVWAGEPVAEIADANQRLQERVLRRAPRAGAARDHVLDQLLR
ETVLALASDWAFMVTHDAGAGYARERAHDHTSRAHRLLDLLESGRYADADALARELRGRD
GVFGHLDARLLPG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacttcgccatggtcctgcacagccacctgccctggctcgccgggcacggccgg
tggccggtcggcgaggagtggctctaccaggcgtgggcctcctcctacctgcccgtggtg
gggatgctggagcggctggccgccgagggccaccgcgacgtgctcaccttcggcctcacc
ccggtgctggccgcgcagctcgacgacccgcactgccttcgcggcttccaccactggctg
ggcaactggcggctgcgcgccgaggaggccgcggcgcgctggcgcggctcgggcgacgag
ctggccgccgccgagtgccgcgcggcctcgcgagcgctggaggagttcgagctgcggtgg
cgccacggcgcgtcgccggtgctgcggccgctggtcgactcggacgtggtcgagctgatc
ggcgggcccgccacgcacccgttccagccgctgctcgacccgcggctgcgcgagttcgcg
ctccggctcgggctggccgacacccggctgcgcctgggcagcgcgccggagggcatctgg
gctccggagtgcgcctacggcccgggcgtggagcgcgagtacgccgcgacgggcgtgcgg
cgcttcctggtcgacggcagcgcgctggacgacgtctccgccgcgcacaccgtcggccgc
accgacatcgtgtgcttcgggcgggacgtgtcgatcagcgacctggtgtggtccgacggc
ggctacccctcgcacccggcctaccgcgacttccacaccttcgaccacgccgtgggcctc
aagccgtcgcgcatcaccggcaaggacgtcgcgccggaggacaagcagccctacgcgctc
ggcccggcggcggcggtggccgacgagcacgccgacgacttcgtggccgccgtgcggcag
cgactggaggagcaccgcgaacgcggcggccgccagggactcgtggtcgcggccttcgac
accgagctgttcgggcactggtggttcgagggtccgcgctggctggaacgggtgttgcgc
acgctgcccgaggccggtgtccgggtgacgacgctgcgcggcgcgctggccgtcggccac
ctgggcgagccggtcgagctgccggagacctcgtggggcgtcgggggtgactggcgcgtg
tgggcgggtgagccggtcgccgagatcgccgacgcgaaccagcggctccaggaacgcgtg
ctgcgccgggcaccgcgggcgggcgccgcccgcgaccacgtcctcgaccagctcctgcgc
gagaccgtgctcgcgctggccagcgactgggcgttcatggtcacccacgacgcgggagcg
ggctacgcccgcgagcgcgcccacgaccacacctcgcgcgcccaccggctgctcgacctg
ctggagtcgggacggtacgccgacgccgacgcgctggcccgcgagctgcgcgggcgcgac
ggcgtgttcggccacctcgacgcccggctgctgcccggctga

DBGET integrated database retrieval system