KEGG   Saccharopolyspora erythraea: SACE_6200Help
Entry
SACE_6200         CDS       T00492                                 

Definition
transferase (EC:2.-.-.-)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6200
Enzymes [BR:sen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SACE_6200
Glycosyltransferases [BR:sen01003]
 Polysaccharide
  Storage polysaccharide
   SACE_6200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
6948602..6949861
Genome map
AA seq 419 aa AA seqDB search
MRVLMLSWEYPPVVVGGLGRHVHALARTLAGQGHDVVVLCRQPAGTDPETHPASDTVVDG
VRLVRVAEDPPHLTFERDLVAWTLAMGHAMVRAGQRLLRGWRPDVVHAHDWLVTHPAIAL
AEAAEVPLVATIHATEAGRHSGWLSQIHSQQIHSVEWWLANRADELITCSAAMRAEAAEL
FDVDPASITVLHNGIETRTWQVRAHDVAAARRSHGRDGAPLLLYFGRLEWEKGVQDLLAA
LPAIRERHPGTTVAIAGCGTHQEWLVERAAEHGVSEAARFTGHLPDTELASLLAAADAVV
LPSRYEPFGIVALEAAAASAPLVASTAGGLGEIVLDGSTGLAFAPGDVAGLADAVDRVLC
DPEAAERRAEAAKARLSSDFDWERIAEGTAAVYAGARRREHAELPRPKIATGNVLGRGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgctgtcctgggaatacccgccggtcgtggtcggcgggctcggccgc
catgtccacgcgctggcccgcaccctggccgggcagggccacgacgtcgtcgtgctgtgc
cgccagccggccgggaccgacccggagacgcacccggccagtgacaccgtcgtcgacggc
gtccggctggtgcgggtcgccgaggacccgccgcacctgaccttcgaacgcgacctcgtc
gcctggacgctggcgatgggccacgcgatggtccgcgcgggccagcgcctgctgcgcgga
tggcggccggacgtcgtgcacgcccacgactggctggtcacccacccggccatcgcgctg
gccgaagccgccgaggtgccgctggtcgccaccatccacgccaccgaggcgggacggcac
agcggctggctgtcgcagatccacagccagcagatccactcggtcgagtggtggctggcg
aaccgggcggacgagctgatcacctgctcggcggcgatgcgggccgaggcggccgagctg
ttcgacgtcgatccggcgtcgatcacggtgctgcacaacgggatcgagacgcggacctgg
caggtccgcgcccacgacgtggccgcggcgcggcgctcgcacgggcgcgacggcgcaccg
ctgctgctctacttcggcaggctggagtgggagaagggcgtccaggacctgctggccgcg
ctgcccgccatccgggagcgccaccccggcacgaccgtggccatcgcgggctgcgggacg
caccaggagtggctcgtcgagcgggccgccgagcacggcgtctccgaggccgcgcgcttc
accgggcacctgcccgacaccgagctggcctccctgctggcggccgcggacgcggtggtg
ctgcccagccgctacgagccgttcggcatcgtcgcgctggaggccgccgccgcgagcgcg
ccgctggtcgcctccaccgcgggcggtctcggcgagatcgtgctcgacgggagcaccggg
ctggcgttcgcaccgggggacgtggccggcctcgccgacgcggtcgaccgggtgctgtgc
gacccggaggcggccgagcgccgcgccgaggcggcgaaggcccggctgagcagcgacttc
gactgggaacgcatcgcggagggcaccgccgccgtctacgcgggcgcgcgccgccgtgag
cacgcggagctgccccgcccgaagatcgccaccggcaacgtgctgggtcgcggcgaatag

DBGET integrated database retrieval system