KEGG   Saccharopolyspora erythraea: SACE_6207Help
Entry
SACE_6207         CDS       T00492                                 

Gene name
echA
Definition
(RefSeq) enoyl-CoA hydratase-isomerase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SACE_6207 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_6207 (echA)
   00650 Butanoate metabolism
    SACE_6207 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_6207 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACE_6207 (echA)
   00310 Lysine degradation
    SACE_6207 (echA)
   00360 Phenylalanine metabolism
    SACE_6207 (echA)
   00380 Tryptophan metabolism
    SACE_6207 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_6207 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACE_6207 (echA)
   00281 Geraniol degradation
    SACE_6207 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACE_6207 (echA)
   00627 Aminobenzoate degradation
    SACE_6207 (echA)
   00930 Caprolactam degradation
    SACE_6207 (echA)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACE_6207 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(6958432..6959214)
Genome map
AA seq 260 aa AA seqDB search
MGEFVRLEVDGAIGTIRLDRPPMNALNRQIERELHDVAIEAAERDDVRAVIVYGGEKVFA
AGADIKEMAEMSYGDMAAKEQRGLSAAMSAVAAIPKPTVAALTGYALGGGFELALTCDRR
IAGDNVKVGQPEILLGVIPGAGGTQRLARLVGPSKAKDIVYTGRFVEAQEALALGMVDEV
VAPDDVYAAARRWAEQFANGAARALAAAKAAIDGGLDVDLDSGLKLETHLFAGTFATEDQ
KIGMRSFIENGPGKAKFTGK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagttcgtcaggcttgaggttgacggtgcgatcggcacgatccggctggatcgg
ccgccgatgaacgcgctgaaccggcagatcgagcgggaactgcacgacgtcgcgatcgag
gcggccgagcgcgacgacgtccgcgccgtgatcgtctacggcggcgagaaggtcttcgcg
gcgggcgccgacatcaaggagatggccgagatgtcctacggggacatggcggccaaggag
cagcgcggcctgtcggcggcgatgagcgcggtcgcggcgatcccgaagcccacggtggcg
gcgctgaccggctacgccctcggcggcgggttcgagctggctctgacctgcgaccgccgc
atcgccggcgacaacgtcaaggtcggccagcccgagatcctgctcggcgtgatccccggc
gcgggcggcacccagcggctggcccggctcgtcggccccagcaaggccaaggacatcgtc
tacaccggacggttcgtcgaggcccaggaggcgctggcgctgggaatggtcgacgaggtc
gtcgcgcccgacgacgtctacgcggcggcccggcgctgggccgagcagttcgctaacggc
gccgcgcgggccctggccgcggccaaggccgccatcgacggcggtctcgacgtcgacctc
gacagcggcctgaagctggagacgcacctgttcgcgggcacgttcgccaccgaggaccag
aagatcgggatgcgctcgttcatcgagaacggtcccggcaaggcgaagttcaccggcaag
tag

DBGET integrated database retrieval system