KEGG   Saccharopolyspora erythraea: SACE_6297Help
Entry
SACE_6297         CDS       T00492                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACE_6297 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_6297 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SACE_6297 (thrC)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SACE_6297 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(7048532..7049611)
Genome map
AA seq 359 aa AA seqDB search
MTSNIQGARAGWPGLIEAYRDRVPVPDGARVVTLQEGNTPLVPAHHLSELTGCEVHLKVE
GANPTGSFKDRGMTVAITHALAEGSKAVICASTGNTSASAAAYASRAGLTSAVLVPQGKI
AMGKLAQAVVHGAKILQVQGNFDDCLELARKTAAEHPVTLVNSVNPVRLEGQKTAAFEIC
DVLGAAPDVHCLPVGNAGNITAYWKGYDEYARDGVISATPAMFGFQAAGAAPLVHGQPVS
NPETIATAIRVGSPASWHGAVAAKDASGGLFSAVSDEQILAAYRLLASREGVFVEPASAS
SVAGLLATVEDGRMPPGSRVVCTVTGHGLKDPDTALSGMVEVEPLPVDPGAVATALELT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgaacatccagggcgcgcgtgccgggtggcccggtctcatcgaggcctaccgg
gaccgcgtcccggtccccgacggtgcgcgcgtggtgaccctccaggagggcaacaccccg
ctggtgcccgcccaccacctctcggagctgaccggctgcgaggtccacctcaaggtcgag
ggcgccaacccgaccggttcgttcaaggaccggggcatgacggtggccatcacgcacgcc
ctcgccgagggcagcaaggcagtcatctgcgcctccaccggcaacacctcggcgtcggcc
gccgcctacgcctcgcgcgccgggctcacctcggccgtgctggtgccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcgtgcacggcgcgaagatcctccaggtgcagggc
aacttcgacgactgcctcgaactggcccgcaagaccgccgccgagcacccggtgaccctg
gtcaactcggtcaacccggtccggctggagggccagaagaccgccgccttcgagatctgc
gacgtgctgggcgccgcgcccgacgtgcactgcctgccggtcggcaacgccggcaacatc
accgcgtactggaagggctacgacgagtacgcccgcgacggggtcatctccgccacgccc
gccatgttcggcttccaggccgccggtgctgcgccgctggtgcacggccagccggtgtcc
aaccccgagacgatcgcgaccgcgatccgggtcggcagccccgcttcctggcacggcgcg
gtggccgccaaggacgcctcgggcggcctgttctcggccgtgagcgacgagcagatcctg
gccgcctaccggcttctggcctcccgcgagggcgtgttcgtcgagcccgcgtcggcctcc
agcgtcgccgggctgctggccaccgtcgaggacggccggatgcccccgggctcgcgcgtg
gtgtgcaccgtgaccgggcacggcctcaaggaccccgacacggcgctgtcgggcatggtc
gaggtcgagccgctgccggtggaccccggcgccgtcgcgacggcgctggagctgacgtga

DBGET integrated database retrieval system