KEGG   Saccharopolyspora erythraea: SACE_6297Help
Entry
SACE_6297         CDS       T00492                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00260  Glycine, serine and threonine metabolism
sen00750  Vitamin B6 metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01230  Biosynthesis of amino acids
Module
sen_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_6297 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SACE_6297 (thrC)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SACE_6297 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAM05469
Cambridge: SACE_6297
Kitasato: SACE_6297
UniProt: A4FN44
Position
complement(7048532..7049611)
Genome map
AA seq 359 aa AA seqDB search
MTSNIQGARAGWPGLIEAYRDRVPVPDGARVVTLQEGNTPLVPAHHLSELTGCEVHLKVE
GANPTGSFKDRGMTVAITHALAEGSKAVICASTGNTSASAAAYASRAGLTSAVLVPQGKI
AMGKLAQAVVHGAKILQVQGNFDDCLELARKTAAEHPVTLVNSVNPVRLEGQKTAAFEIC
DVLGAAPDVHCLPVGNAGNITAYWKGYDEYARDGVISATPAMFGFQAAGAAPLVHGQPVS
NPETIATAIRVGSPASWHGAVAAKDASGGLFSAVSDEQILAAYRLLASREGVFVEPASAS
SVAGLLATVEDGRMPPGSRVVCTVTGHGLKDPDTALSGMVEVEPLPVDPGAVATALELT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgaacatccagggcgcgcgtgccgggtggcccggtctcatcgaggcctaccgg
gaccgcgtcccggtccccgacggtgcgcgcgtggtgaccctccaggagggcaacaccccg
ctggtgcccgcccaccacctctcggagctgaccggctgcgaggtccacctcaaggtcgag
ggcgccaacccgaccggttcgttcaaggaccggggcatgacggtggccatcacgcacgcc
ctcgccgagggcagcaaggcagtcatctgcgcctccaccggcaacacctcggcgtcggcc
gccgcctacgcctcgcgcgccgggctcacctcggccgtgctggtgccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcgtgcacggcgcgaagatcctccaggtgcagggc
aacttcgacgactgcctcgaactggcccgcaagaccgccgccgagcacccggtgaccctg
gtcaactcggtcaacccggtccggctggagggccagaagaccgccgccttcgagatctgc
gacgtgctgggcgccgcgcccgacgtgcactgcctgccggtcggcaacgccggcaacatc
accgcgtactggaagggctacgacgagtacgcccgcgacggggtcatctccgccacgccc
gccatgttcggcttccaggccgccggtgctgcgccgctggtgcacggccagccggtgtcc
aaccccgagacgatcgcgaccgcgatccgggtcggcagccccgcttcctggcacggcgcg
gtggccgccaaggacgcctcgggcggcctgttctcggccgtgagcgacgagcagatcctg
gccgcctaccggcttctggcctcccgcgagggcgtgttcgtcgagcccgcgtcggcctcc
agcgtcgccgggctgctggccaccgtcgaggacggccggatgcccccgggctcgcgcgtg
gtgtgcaccgtgaccgggcacggcctcaaggaccccgacacggcgctgtcgggcatggtc
gaggtcgagccgctgccggtggaccccggcgccgtcgcgacggcgctggagctgacgtga

DBGET integrated database retrieval system