KEGG   Saccharopolyspora erythraea: SACE_6308Help
Entry
SACE_6308         CDS       T00492                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6308
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SACE_6308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(7060653..7062812)
Genome map
AA seq 719 aa AA seqDB search
MSRRWRTPLLGICVAAAVAGTALPSSAARAGDAPGAPGTDPGYAGADKLGFGTSRDAQSP
VWFTLGRGGAADLYYPNLSTPASRQLQVVVTDGAGFVQRLSDVPTRTEPVDPKTPSYRQV
STGQGWEATATYVTDPARPSVVVDLQVRSLDGKPLQTYVLHEPTLTKDGSDDRSRTEGAT
LVASDRSAASALRATPAFTETSSGYLGASDGWTDLSRHKRLTAHHPEAGAGHVGQVGRLP
VDGVGTSHAVLTLGYGKHASEAVATAEETERTGFEAAARAYGEGWHRYADSLTPPDALTD
EHQKNVYWSSTAMLAASEDKQNPGAFIASPSMPWAFRNDPEMAPESGPYHLVWPRDLYQH
ATALLSAGDRAAAERALDYLWSVQQPDGHLPQNTETSGEPFWTKVQLDQTAFPIVLAWQL
GRTDQATMDGVRKAAEFIVGFEHEGHPAPYTEQERWENHSGYSPGTIASTIAGLVCAADL
LERSGDHETAQRYLAVADEWAAKVDGWTATANGPHSPQPYYLRLTKDGNPNQGTTYNPGD
NYPEDVDQRTQVDPSFLELVRLGVKRPDDPVVVNSLRVVDEVLGEQTPAGQHWHRFTSDG
YGEREDGADWNIGHGRTYGRLWPLFAGERGEYELMAGQPGMAAERLRSMAATANEGLLLP
EQVWDNRAPAADGEPAPGTPNRSATPLAWTHAQYVRLVTSMAAGAPVETPSVVADRYTR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
ttgtccagacgatggcgaacaccgctgctggggatctgcgtggcggcggcggtcgcgggc
accgcgctgccctcgtcggccgcgcgagcgggcgacgcaccgggcgcgcccggcaccgac
cccggctacgccggcgccgacaagctcggcttcgggacctcgcgcgacgcgcagagcccg
gtgtggttcaccctcggccgcggcggtgccgcggatctctactacccgaacctgtcgacg
ccggcgtcccggcagctccaggtcgtcgtgaccgacggggccggcttcgtccagcgcctg
tccgacgtccccacgcgcaccgagccggtcgacccgaagaccccgtcgtaccgccaggtc
tcgaccgggcagggctgggaggccaccgccacctacgtcaccgacccggcgcgcccgtcg
gtcgtggtcgacctccaggtgcggtcgctggacggcaagccgttgcagacctacgtcctg
cacgagccgaccctgaccaaggacggctccgacgaccgcagccggaccgaaggcgcgacg
ctggtggcgtccgaccgctcggcggccagcgcgctgcgcgcgaccccggccttcaccgag
acctcctccggatacctcggcgccagcgacggctggaccgacctgtcgcggcacaagcgg
ctcaccgcgcaccaccccgaagccggcgccgggcacgtcggccaggtcgggcggctgccc
gtggacggcgtgggaacctcgcacgccgtgctcaccctcggctacggcaagcacgccagc
gaggccgtcgcgacggcggaggagacggagcggaccgggttcgaggccgccgcccgcgcc
tacggcgagggctggcaccgctacgccgactcgctcacgcccccggacgcgctgaccgac
gagcaccagaagaacgtgtactggagctccacggcgatgctcgcggccagcgaggacaag
cagaacccgggtgcgttcatcgcgtcgccgagcatgccgtgggcgttccgcaacgacccg
gagatggctccggagtccgggccctaccacctggtgtggccgcgtgacctctaccagcac
gcgaccgcgctgctgtcggcgggcgaccgggcggcggccgagcgggcgctggactacctg
tggtcggtgcagcagcccgacgggcacctgccgcagaacaccgagacctccggcgagccg
ttctggaccaaggtccagctcgaccagacggcgttcccgatcgtgctcgcctggcagctc
gggcgcaccgaccaggcgacgatggacggcgtccgcaaggccgcggagttcatcgtcggc
ttcgagcacgaggggcacccggccccgtacaccgagcaggagcggtgggagaaccacagc
ggctactcgccgggcacgatcgcctcgacgatcgcgggcctggtgtgcgccgcggacctg
ctggagcgcagcggcgaccacgagaccgcccagcggtacctggccgtcgccgacgaatgg
gcggccaaggtagacgggtggaccgcgaccgccaacggcccccactcaccgcagccctac
tacctgcggctgaccaaggacggcaacccgaaccagggcacgacctacaacccgggcgac
aactacccggaggacgtcgaccagcgcacccaggtggacccgagcttcctggaactggtc
cggctgggcgtcaagcggcccgacgacccggtggtggtgaactcgctgcgcgtcgtcgac
gaggtgctgggggagcagacgcccgcggggcagcactggcaccggttcaccagcgacggc
tacggcgagcgcgaggacggcgcggactggaacatcggccacggccgcacctacggcagg
ctctggccgctgttcgcgggtgaacgcggtgagtacgagctgatggcgggtcagcccggc
atggccgccgaacgcctgcggtcgatggcggcgacggcgaacgaggggctgctgctgccg
gagcaggtctgggacaaccgggcacccgccgccgacggcgagcccgcgcccggtacgccc
aaccgctcggccaccccgctggcgtggacccacgcccagtacgtccggctcgtcacgtcg
atggcggcgggcgcgcccgtggaaaccccgtcggtcgtcgcggaccgctacacccgctga

DBGET integrated database retrieval system