KEGG   Saccharopolyspora erythraea: SACE_6362Help
Entry
SACE_6362         CDS       T00492                                 

Gene name
fadB
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00071  Fatty acid degradation
sen00280  Valine, leucine and isoleucine degradation
sen00281  Geraniol degradation
sen00310  Lysine degradation
sen00362  Benzoate degradation
sen00380  Tryptophan metabolism
sen00410  beta-Alanine metabolism
sen00640  Propanoate metabolism
sen00650  Butanoate metabolism
sen00903  Limonene and pinene degradation
sen00930  Caprolactam degradation
sen01040  Biosynthesis of unsaturated fatty acids
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
sen01212  Fatty acid metabolism
Module
sen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_6362 (fadB)
   00650 Butanoate metabolism
    SACE_6362 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_6362 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SACE_6362 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACE_6362 (fadB)
   00310 Lysine degradation
    SACE_6362 (fadB)
   00380 Tryptophan metabolism
    SACE_6362 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_6362 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACE_6362 (fadB)
   00281 Geraniol degradation
    SACE_6362 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACE_6362 (fadB)
   00930 Caprolactam degradation
    SACE_6362 (fadB)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SACE_6362 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACE_6362 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SACE_6362 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH AlaDh_PNT_C NAD_binding_2 NAD_binding_7 2-Hacid_dh_C F420_oxidored PALP NAD_Gly3P_dh_N Pyr_redox_2 UDPG_MGDP_dh_N Oxidored_nitro Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CAM05532
Cambridge: SACE_6362
Kitasato: SACE_6362
UniProt: A4FNA7
Position
complement(7124827..7127040)
Genome map
AA seq 737 aa AA seqDB search
MSEQSTIRWTEEDGVVVLTLDDPQQQANTMNERYVRSMEETLQRLEDERERITGVVLTSA
KSTFFAGGDLRDLIRARPENVQQITETSRAVKQQLRRLETLGVPVVAALNGTALGGGLEI
ALGCHHRVALNDAKSRFGFPEVTLGLLPGAGGVVRTVRLIGIADALVHVLTQGQRLRPER
AKELGLVDELVDTPEELLTAAKDWIKANPQADQPWDRKGYKIPGGTPSTPSFAANLPAFP
ANLRKQLKGAPYPAPRNILCAAVEGAQVDVDTAFEIEGRYFVELVCGQTAKNMSKAFFFD
LQHVNSGGSRPDGVEQWQAKKVAVLGGGMMGAGIAHVCAKAGMQVVIKDVSVEAAEKGKA
YSKTVLDKAIAKGRSTEAKRDEVLARITATDKAADLAGADLVIEAVFEDTKLKHQVYAEI
EDVIDPDALICSNTSTLPITTLAEGVRRREDFIGLHFFSPVDKMPLVEIIRGERTSDRAL
ARAFDVVRQISKTPIVVNDSRGFFTSRVIGTFLNEGVAMLAEGVHPASIEQASAQAGFPA
PVLQLFDELTLTLPRRIREETRRAVEAQGGTWAPHPADAVLDRMVEEFDRKGRSGGAGFY
EYADGKRTRLWPGLLEHFGTGADPSDVDLVDLRERMLFIEALETVRCLDEGVLLSVPDAN
IGSIMGIGFPAWTGGVVQYMNGYPGGLAGFVARSRELAARYGERFEPPASLVRRAEAGEP
FELGEPDAAIVAAAAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagagcaccatccgctggaccgaggaagacggcgtcgtcgtgctgaccctg
gacgacccgcagcagcaggccaacacgatgaacgagcgctacgtgcgctcgatggaggag
accctccagcggctggaggacgagcgcgagcgcatcaccggggtcgtgctcacctcggcc
aagagcaccttcttcgccggcggcgacctgcgcgacctgatccgcgcgcggcccgagaac
gtccagcagatcaccgagaccagccgggccgtcaagcagcagctgcgcaggctggagacg
ctcggcgtcccggtcgtggccgccctcaacggcaccgcgctcggcggcggcctggagatc
gccctgggctgccaccaccgcgtcgcgctcaacgacgccaagtcgcgcttcggattcccc
gaggtcaccctcggcctgctgcccggcgcgggcggcgtggtccgcacggtccggctgatc
ggcatcgccgacgcgctggtgcacgtgctgacccagggccagcggctgcgcccggagcgg
gccaaggagctcggcctggtcgacgagctggtcgacacccccgaggaactgctgaccgcg
gccaaggactggatcaaggccaacccgcaggcggaccagccctgggaccgcaagggctac
aagatccccggcgggacgccgtcgacgccgagcttcgcggcgaacctgcccgcgttcccg
gccaacctgcgcaagcagctcaagggcgcgccgtacccggcgccgcgcaacatcctctgc
gcggcggtcgagggcgcccaggtcgacgtggacaccgcgttcgagatcgagggccgctac
ttcgtcgagctggtctgcggccagaccgccaagaacatgagcaaggcgttcttcttcgac
ctccagcacgtcaactccggcggcagccgcccggacggcgtcgagcagtggcaggcgaag
aaggtcgcggtgctcggcggcggcatgatgggcgcgggcatcgcccacgtctgcgccaag
gccgggatgcaggtcgtcatcaaggacgtctccgtcgaggccgccgagaagggcaaggcg
tactcgaagacggtgctggacaaggccatcgccaaggggcgttccaccgaggccaagcgc
gacgaggtcctggcgcggatcaccgcaaccgacaaggccgcggacctggcgggcgccgac
ctggtgatcgaggcggtcttcgaggacaccaagctcaagcaccaggtctacgccgagatc
gaggacgtcatcgacccggacgcgctgatctgctccaacacctccacgctgccgatcacc
acgctggccgagggcgtccgccgccgcgaggacttcatcgggctgcacttcttctcgccg
gtcgacaagatgccgctggtggagatcatccgcggggagcggaccagcgaccgcgcgctg
gcgcgcgccttcgacgtcgtgcgccagatcagcaagacgccgatcgtggtcaacgacagc
cgcggtttcttcaccagccgcgtcatcggcacgttcctcaacgagggcgtggcgatgctc
gccgagggcgtgcacccggcctcgatcgagcaggcttcggcgcaggccggcttcccggct
ccggtgctccagctcttcgacgagctgaccctgaccctgccgcgcaggatcagggaggag
accaggcgcgccgtcgaggcgcagggcggcacctgggccccgcaccccgccgacgcggtg
ctggaccggatggtcgaggagttcgaccgcaagggccgctccggcggagccggtttctac
gagtacgccgacggaaagcgcacccggctgtggcctggtctgctcgagcacttcggcacc
ggcgccgatccgtccgatgtggacctcgtcgacctccgcgagcggatgctgttcatcgag
gcgctggagacggtgcgctgcctcgacgagggcgtgctgctgtcggtgcccgacgccaac
atcggttcgatcatgggcatcggtttcccggcctggaccggcggcgtcgtgcagtacatg
aacggctacccgggcggtctggccggtttcgtcgcgcggtcgcgggagctggcggcccgc
tacggcgagcgcttcgagccgccggcgtcgctggtgcgtcgcgcggaggccggtgagccg
ttcgagctgggcgagcccgacgccgccatcgtggccgccgccgcggccgcctga

DBGET integrated database retrieval system