KEGG   Saccharopolyspora erythraea: SACE_6518Help
Entry
SACE_6518         CDS       T00492                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SACE_6518 (glpK)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SACE_6518 (glpK)
Exosome [BR:sen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SACE_6518 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7311618..7313120
Genome map
AA seq 500 aa AA seqDB search
MASYVAAIDQGTTSTRCMIFNHSGRVVAVDQVEHRQIFPRAGWVEHDPEEIWSNTRQVCA
GALAKADLVTSEIAAVGITNQRETTVVWDRKTGKPVYNAIVWQDTRTDSIVNELAADGGQ
NRYHRKTGLPLATYFSGTKIRWILDNVDGVRARAEKGELLFGNMDTWVLWNSTGGPDGGL
HVTDPTNASRTLLMDLETLDWDTDICAEFGIPTSMLPEIRSSSEVYGHFRERGVFGGLPI
AGILGDQQAATFGQACLSPGEAKNTYGTGNFLLLNTGTERVLSENGLLTTVGYKIGGNDT
VYCLEGSIAVTGSLVQWLRDNLGLIASAPEIEQLARTVDDNGGAYFVPAFSGLFAPHWRS
DARGAIVGLTRFVDRGHLARAVLEATAFQTREVIEAMNADSGVPLKSLKVDGGMVGNELL
MQFQADILGVPVIRPVVSETTALGAAYAAGLAVGFWGSEEDIRSNWAKDKQWDPLMPEEK
REAEYRQWQKAVTKTFDWVE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctacgtcgcagcaatcgaccagggcaccacctcgacccggtgcatgatcttc
aaccactcgggccgggtcgtcgccgtggaccaggtggagcaccgccagatcttcccgcgc
gcgggatgggtcgagcacgacccggaggagatctggagcaacaccaggcaggtctgcgcc
ggcgcgctggccaaggccgacctggtgacctccgagatcgccgcggtcggcatcaccaac
cagcgcgagacgaccgtggtgtgggaccgcaagaccggcaagccggtctacaacgccatc
gtctggcaggacaccaggaccgacagcatcgtcaacgagctcgccgccgacggcgggcag
aaccgctaccaccgcaagaccggtctgccgctggcgacctacttctccggcaccaagatc
cgctggatcctggacaacgtggacggtgtccgcgcccgtgccgagaagggcgagctgctg
ttcggcaacatggacacctgggtgctgtggaactccacgggcggtcccgacggcggtctg
cacgtgaccgacccgaccaacgcctcgcgcaccctgctgatggacctggagaccctggac
tgggacaccgacatctgcgccgagttcggcatcccgacgtcgatgctgccggagatccgc
tcgtcgtcggaggtctacgggcacttccgcgagcgcggggtgttcggcgggctgccgatc
gcgggcatcctcggcgaccagcaggccgccaccttcgggcaggcgtgcctgtcgcccggt
gaagccaagaacacctacggcaccggcaacttcctgctgctcaacaccggcaccgagcgg
gtgctcagcgagaacgggctgctgaccacggtcggctacaagatcggcggcaacgacacc
gtctactgcctggagggctcgatcgcggtcaccggctcgctggtgcagtggctgcgcgac
aacctcgggctcatcgccagcgcgccggagatcgagcagctcgcgcggaccgtcgacgac
aacggcggcgcctacttcgtcccggcgttctccgggctgttcgcgccgcactggcgatcc
gacgcgcgcggcgcgatcgtcggcctgacccggttcgtcgaccgcgggcacctggcccgc
gcggtgctggaggccacggcgttccagacccgcgaggtgatcgaggcgatgaacgccgac
tccggggtgccgctgaagtcgctgaaggtcgacggcggcatggtcggcaacgaactgctc
atgcagttccaggccgacatcctcggcgtgccggtgatccgtccggtggtcagcgagacg
acggcgctcggcgccgcctacgcggcgggcctcgccgtcggcttctggggcagcgaggag
gacatccgctccaactgggccaaggacaagcagtgggacccgctcatgccggaggagaag
cgggaagccgagtaccgccagtggcagaaggccgtgaccaagaccttcgactgggtcgag
tga

DBGET integrated database retrieval system