KEGG   Saccharopolyspora erythraea: SACE_6562Help
Entry
SACE_6562         CDS       T00492                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00625  Chloroalkane and chloroalkene degradation
sen00680  Methane metabolism
sen01100  Metabolic pathways
sen01120  Microbial metabolism in diverse environments
sen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SACE_6562 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_6562 (fdhA)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SACE_6562 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc HI0933_like AlaDh_PNT_C ADH_zinc_N_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CAM05730
Cambridge: SACE_6562
Kitasato: SACE_6562
UniProt: A4FNV5
Position
complement(7357165..7358298)
Genome map
AA seq 377 aa AA seqDB search
MRAVVYQEPFSVAVDEVDTPTIQHPNDVLVRVTSTAICGSDLHMYEGRTAAEPGIVFGHE
NLGIIEEVGSGVVSLQRGDRVVMPFNVACGFCKNCLARDTGFCLTVNPGFAGGAYGYVAM
GPYTGGQAEYLRVPFADFNCLKLPSDSSKESDYVLLADIFPTGYHGCELAQVSPGETCVV
YGAGPVGLMAAYSAMLRGASRVFCVDRVPERLAKAEEIGAIPIDFSKGDPVQQIKDQTDG
EGTDKGVDAVGYQAQVGDSSKEEPAVVLNSLIETVRPTGRLGVPGLYVPADPGGPDSNAQ
QGKLLVSIGRMFEKGQVMGTGQCNVKRYNRQLRDMITAGRANPSFVVSHELSLSEAPDAY
RKFDQRIEGYTKVVLHP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtggtgtaccaggaaccgttctcggtcgcggtggacgaagtggacacgccc
accatccaacatccgaacgacgtgctcgtacgggtgacgtcaaccgcgatctgcgggtcc
gacctgcacatgtacgaggggaggacggccgcggagccaggcatcgtgttcggccacgag
aacctcggcatcatcgaggaggtcggctccggcgtggtgagcctgcaacggggtgacagg
gtcgtaatgcccttcaacgtcgcatgcgggttctgcaagaactgcctggcgcgcgacacc
gggttctgcctcacggtcaaccccggcttcgcgggcggggcctacggctacgtggcgatg
ggtccctacaccggcgggcaggcggagtacctgcgggtgcccttcgctgacttcaactgc
ctgaagctgccgtcggactccagcaaggagagcgactacgtcctgttggccgacatcttc
cccaccggctaccacggctgcgagctggcgcaggtctcgcccggcgagacgtgcgtggtg
tacggggcggggccggtcggcctgatggccgcctactcggccatgctgcgcggggcatcg
cgggtgttctgcgtggaccgggtcccggagcggctggccaaggcggaggagatcggcgcg
atcccgatcgacttcagcaagggcgacccggtgcagcagatcaaggaccagaccgacggc
gagggcaccgacaagggcgtcgacgcggtcggctaccaggcgcaggtcggcgactcctcc
aaggaggagccggcggtggtgctgaactcgctgatcgaaaccgtgcgccccaccggccga
ctcggagtgcccggactgtacgtgccggccgaccccggaggaccggacagcaacgcccag
cagggcaagctcctggtctccatcggccgcatgttcgagaagggccaggtcatgggcacc
ggccagtgcaacgtcaagcgctacaaccggcagctccgcgacatgatcacggccggacgg
gccaaccccagcttcgtcgtctcccacgagctgtcgctctcggaggcgccggacgcctac
cgcaagttcgaccaacgcatcgagggctacacgaaggtcgtcctgcacccgtaa

DBGET integrated database retrieval system