KEGG   Saccharopolyspora erythraea: SACE_6583Help
Entry
SACE_6583         CDS       T00492                                 

Definition
(GenBank) probable succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00020  Citrate cycle (TCA cycle)
sen00190  Oxidative phosphorylation
sen00650  Butanoate metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Module
sen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sen_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACE_6583
   00650 Butanoate metabolism
    SACE_6583
  Energy metabolism
   00190 Oxidative phosphorylation
    SACE_6583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAM05750
Cambridge: SACE_6583
Kitasato: SACE_6583
UniProt: A4FNX5
Position
7379411..7379830
Genome map
AA seq 139 aa AA seqDB search
MTTTEAPLSVDKPRSPSRPAARRSNFELYSWLFMRLSGVVLLFLVLGHLLIMLFLDGGVH
RVNFAFVAGRWSSPFWQFWDLTMLWLAGLHGGNGLRTVINDYSRKDGTRFWLKVLLYASV
LLTVGLGSFVLFTFDPNIG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacggaagcaccgctgtcggtcgacaagccccgctcgccgtcgcgcccggcg
gcgcgccggagcaacttcgagctctacagctggctgttcatgcggctgtccggcgtcgtc
ctgctgttcctcgtgctgggtcacctgctgatcatgctgttcctggacggcggcgtgcac
cgggtcaacttcgccttcgtggcggggcgctggtcgtccccgttctggcagttctgggac
ctgacgatgctgtggctggccggtctgcacggcggcaacggcctgcgtaccgtcatcaac
gactactcccgcaaggacggcacccgcttctggctgaaggtgctgctgtacgcgtcggtg
ctgctgacggtcggtctggggagcttcgtgctcttcaccttcgacccgaacatcggctga

DBGET integrated database retrieval system