KEGG   Saccharopolyspora erythraea: SACE_6583Help
Entry
SACE_6583         CDS       T00492                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sen  Saccharopolyspora erythraea
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_6583
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACE_6583
   00650 Butanoate metabolism
    SACE_6583
  Energy metabolism
   00190 Oxidative phosphorylation
    SACE_6583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7379411..7379830
Genome map
AA seq 139 aa AA seqDB search
MTTTEAPLSVDKPRSPSRPAARRSNFELYSWLFMRLSGVVLLFLVLGHLLIMLFLDGGVH
RVNFAFVAGRWSSPFWQFWDLTMLWLAGLHGGNGLRTVINDYSRKDGTRFWLKVLLYASV
LLTVGLGSFVLFTFDPNIG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacggaagcaccgctgtcggtcgacaagccccgctcgccgtcgcgcccggcg
gcgcgccggagcaacttcgagctctacagctggctgttcatgcggctgtccggcgtcgtc
ctgctgttcctcgtgctgggtcacctgctgatcatgctgttcctggacggcggcgtgcac
cgggtcaacttcgccttcgtggcggggcgctggtcgtccccgttctggcagttctgggac
ctgacgatgctgtggctggccggtctgcacggcggcaacggcctgcgtaccgtcatcaac
gactactcccgcaaggacggcacccgcttctggctgaaggtgctgctgtacgcgtcggtg
ctgctgacggtcggtctggggagcttcgtgctcttcaccttcgacccgaacatcggctga

DBGET integrated database retrieval system