KEGG   Saccharopolyspora erythraea: SACE_6685Help
Entry
SACE_6685         CDS       T00492                                 

Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00072  Synthesis and degradation of ketone bodies
sen00650  Butanoate metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SACE_6685
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SACE_6685
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SACE_6685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 F420_oxidored Sacchrp_dh_NADP TrkA_N Shikimate_DH KR 2-Hacid_dh_C RmlD_sub_bind NAD_binding_2 3HCDH_N NAD_binding_7 ApbA THF_DHG_CYH_C 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: CAM05851
Cambridge: SACE_6685
Kitasato: SACE_6685
UniProt: A4FP76
Position
complement(7485661..7486467)
Genome map
AA seq 268 aa AA seqDB search
MSDRSDDLDANGSGESGGAGTTFLAGRRAVVTGGGSGIGAAVSRRLAEAGASVLVVDRNA
ESAERVAAEIGGEARIVDLSDPDAAAEVGPGADVVVNNAGMQHVAPVHQFPPDTFSRMLA
VMLESPFRIVRAALPGMYDRGWGRIINVSSIHGLRASPYKSAYVTVKHGLEGLSKTIALE
GASHGVTSNCICPGFVRTPLVERQVAEQAVLHRVPEAQVVEDVLLARTPVKRLVEPDEVA
ALAVWLCGPGTSSVTGSSFPIDGGWAAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgctcggacgacctcgatgcgaacggttccggggaaagcgggggtgcaggc
acgaccttcctcgcgggcaggcgcgccgtcgtcaccggtgggggcagcggcatcggggcg
gcggtgtcccggcggctggccgaggctggggcctcggtgctggtcgtggaccgcaacgcc
gagtccgcggagcgggtcgcggccgagatcggcggcgaggccaggatcgtcgacctcagc
gacccggacgccgcggccgaggtcggcccgggcgccgacgtcgtggtcaacaacgcgggc
atgcagcacgtggcaccggtgcaccagttcccgccggacaccttcagccggatgctcgcg
gtgatgctggagtcgccgttccggatcgtccgcgcggccctgccgggcatgtacgaccgg
ggctgggggcgcatcatcaacgtctcctccatccacggtctgcgcgcatcgccctacaag
agcgcgtacgtgacggtgaagcacgggctggaaggcctgtccaagacgatcgcgctcgaa
ggcgcctcgcacggcgtcacctccaactgcatatgccccgggttcgtccgcacgccgctg
gtcgagcggcaggtcgccgagcaggcggtcctgcaccgcgtgccggaggcccaggtcgtc
gaggacgtgctgctggcgcgcactcccgtcaagcggctggtcgagcccgacgaggtggcc
gcgctggcggtctggttgtgcgggccgggcaccagctcggtcaccggctcgtcgttcccc
atcgacggtggctgggccgcccactga

DBGET integrated database retrieval system