KEGG   Saccharopolyspora erythraea: SACE_6705Help
Entry
SACE_6705         CDS       T00492                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sen  Saccharopolyspora erythraea
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:sen00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(7508276..7509979)
Genome map
AA seq 567 aa AA seqDB search
MSSRDGAHDYDVVVIGSGFGGSVAALRLTEKGYRVAVLEAGRRFADEEFAKTSWDLRNFL
WAPQVGCYGIQRIHLLRDVLILAGSGVGGGSLVYANTLYRPLKPFYSDSQWAHITDWEDE
LAPHYDQASRMLGVVTNPTTTPSDVVIREVAEEMGVGESYHPTPVGVYFGKPGEQVADPY
FGGAGPSRTGCTECGSCMTGCRVGAKNTLVKNYLHLAEAGGAEVWPLTTVHRLAQGADGR
WRIGTRRTGARFDRDAKVFTADQVVVAAGTWGTQNLLHRARERGDLPRMSERLGVLTRTN
SEAIIGAQTSRVLPGKDFSTGVAITSSFHPDEDTHIEPVRYGKGSNAMGMLQTLPTSGGS
PVPRWKQWLRFFGKHPLFSLRLLWVKNWSERTVILLVMQSLDNSLTTKLRKGIFGRRRLT
SQQGHGAPNPTCIPAGEEANNRVAEKLGGIAGGTWGELLDMPMTAHFIGGCPIGQDAEHG
VVDPYHRAFGYPTMSIVDGSAISANLGVNPSLTITAQAERAFSLWPNKGEPDPRPAQEEG
YRRVERVAPKSPAVPADAPAALRTPPA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacgtgacggggcgcacgactacgacgtcgtggtgatcgggtcggggttcggc
ggcagcgtggccgccctgcggctcaccgagaagggctaccgcgtcgcggtcctcgaagcc
ggccgcaggttcgccgacgaggagttcgcgaagacctcgtgggacctgcgcaacttcctc
tgggccccgcaggtcggctgctacggcatccagcggatccacctgctgcgtgacgtgctc
atcctcgccggctccggcgtcggcggcggctcgctggtctacgcgaacacgctctaccgg
ccgctgaagccgttctactcggactcccagtgggcgcacatcaccgactgggaggacgag
ctcgccccgcactacgaccaggcgagccggatgctgggcgtggtcaccaaccccaccacc
actccctcggacgtggtgatcagggaggtggccgaggagatgggcgtgggcgagagctac
caccccactccggtcggggtgtacttcggcaaaccgggggagcaggtcgccgacccgtac
ttcggcggagccgggccctcgcgcaccggctgcaccgagtgcggctcctgcatgaccggc
tgccgcgtgggggccaagaacaccctggtgaagaactacctgcacctggcggaggccggc
ggcgccgaggtgtggccgctgaccaccgtgcaccggctggcgcagggcgccgacggccgc
tggcgcatcggcacgcggcgcaccggggcgaggttcgaccgcgacgcgaaggtgttcacc
gccgaccaggtcgtggtcgccgccgggacctggggcacccagaacctgctgcaccgggcg
cgcgagcgcggtgacctgccgcgcatgtcggagcggctcggcgtgctcacccgcaccaac
tccgaggcgatcatcggggcgcagacctcgagggtgctgccgggcaaggacttctcgacc
ggggtggcgatcacctcgtcgttccaccccgacgaggacacccacatcgagccggtgcgc
tacggcaagggcagcaacgccatgggcatgctgcagaccctgccgacgtcgggcggttcg
ccggtgccgcgctggaagcagtggctgcgcttcttcggcaagcacccgctcttctcgctg
cggctgctgtgggtgaagaactggagcgagcgcacggtgatcctgctggtcatgcagagc
ctcgacaactcgctgaccacgaagctgcgcaaggggatcttcggccgcaggcggctgacc
tcccagcagggccacggcgctccgaacccgacctgcatcccggcgggcgaggaggccaac
aaccgggtcgccgagaagctcggcggcatcgcgggcggcacgtggggcgaactgctggac
atgccgatgacggcgcacttcatcggcggctgccccatcggccaggacgccgagcacggc
gtcgtcgacccctaccaccgtgctttcggctacccgacgatgtccatcgtggacggttcg
gcgatctcggcgaacctcggcgtgaacccgtcgctgacgatcaccgcgcaggcggagcgc
gccttctcgctgtggccgaacaagggcgagccggacccgcgtcccgcgcaggaggaggga
taccggcgggtcgagcgggtcgcgccgaagtcccccgccgtcccggccgatgccccggcc
gccctgcggacgcctccggcgtag

DBGET integrated database retrieval system