KEGG   Saccharopolyspora erythraea: SACE_6705Help
Entry
SACE_6705         CDS       T00492                                 

Gene name
choD
Definition
(GenBank) cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00984  Steroid degradation
sen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SACE_6705 (choD)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SACE_6705 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 GIDA HI0933_like FAD_binding_3 Pyr_redox FAD_oxidored Fer4_9 Thi4 Fer4
Motif
Other DBs
NCBI-ProteinID: CAM05871
Cambridge: SACE_6705
Kitasato: SACE_6705
UniProt: A4FP96
Position
complement(7508276..7509979)
Genome map
AA seq 567 aa AA seqDB search
MSSRDGAHDYDVVVIGSGFGGSVAALRLTEKGYRVAVLEAGRRFADEEFAKTSWDLRNFL
WAPQVGCYGIQRIHLLRDVLILAGSGVGGGSLVYANTLYRPLKPFYSDSQWAHITDWEDE
LAPHYDQASRMLGVVTNPTTTPSDVVIREVAEEMGVGESYHPTPVGVYFGKPGEQVADPY
FGGAGPSRTGCTECGSCMTGCRVGAKNTLVKNYLHLAEAGGAEVWPLTTVHRLAQGADGR
WRIGTRRTGARFDRDAKVFTADQVVVAAGTWGTQNLLHRARERGDLPRMSERLGVLTRTN
SEAIIGAQTSRVLPGKDFSTGVAITSSFHPDEDTHIEPVRYGKGSNAMGMLQTLPTSGGS
PVPRWKQWLRFFGKHPLFSLRLLWVKNWSERTVILLVMQSLDNSLTTKLRKGIFGRRRLT
SQQGHGAPNPTCIPAGEEANNRVAEKLGGIAGGTWGELLDMPMTAHFIGGCPIGQDAEHG
VVDPYHRAFGYPTMSIVDGSAISANLGVNPSLTITAQAERAFSLWPNKGEPDPRPAQEEG
YRRVERVAPKSPAVPADAPAALRTPPA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacgtgacggggcgcacgactacgacgtcgtggtgatcgggtcggggttcggc
ggcagcgtggccgccctgcggctcaccgagaagggctaccgcgtcgcggtcctcgaagcc
ggccgcaggttcgccgacgaggagttcgcgaagacctcgtgggacctgcgcaacttcctc
tgggccccgcaggtcggctgctacggcatccagcggatccacctgctgcgtgacgtgctc
atcctcgccggctccggcgtcggcggcggctcgctggtctacgcgaacacgctctaccgg
ccgctgaagccgttctactcggactcccagtgggcgcacatcaccgactgggaggacgag
ctcgccccgcactacgaccaggcgagccggatgctgggcgtggtcaccaaccccaccacc
actccctcggacgtggtgatcagggaggtggccgaggagatgggcgtgggcgagagctac
caccccactccggtcggggtgtacttcggcaaaccgggggagcaggtcgccgacccgtac
ttcggcggagccgggccctcgcgcaccggctgcaccgagtgcggctcctgcatgaccggc
tgccgcgtgggggccaagaacaccctggtgaagaactacctgcacctggcggaggccggc
ggcgccgaggtgtggccgctgaccaccgtgcaccggctggcgcagggcgccgacggccgc
tggcgcatcggcacgcggcgcaccggggcgaggttcgaccgcgacgcgaaggtgttcacc
gccgaccaggtcgtggtcgccgccgggacctggggcacccagaacctgctgcaccgggcg
cgcgagcgcggtgacctgccgcgcatgtcggagcggctcggcgtgctcacccgcaccaac
tccgaggcgatcatcggggcgcagacctcgagggtgctgccgggcaaggacttctcgacc
ggggtggcgatcacctcgtcgttccaccccgacgaggacacccacatcgagccggtgcgc
tacggcaagggcagcaacgccatgggcatgctgcagaccctgccgacgtcgggcggttcg
ccggtgccgcgctggaagcagtggctgcgcttcttcggcaagcacccgctcttctcgctg
cggctgctgtgggtgaagaactggagcgagcgcacggtgatcctgctggtcatgcagagc
ctcgacaactcgctgaccacgaagctgcgcaaggggatcttcggccgcaggcggctgacc
tcccagcagggccacggcgctccgaacccgacctgcatcccggcgggcgaggaggccaac
aaccgggtcgccgagaagctcggcggcatcgcgggcggcacgtggggcgaactgctggac
atgccgatgacggcgcacttcatcggcggctgccccatcggccaggacgccgagcacggc
gtcgtcgacccctaccaccgtgctttcggctacccgacgatgtccatcgtggacggttcg
gcgatctcggcgaacctcggcgtgaacccgtcgctgacgatcaccgcgcaggcggagcgc
gccttctcgctgtggccgaacaagggcgagccggacccgcgtcccgcgcaggaggaggga
taccggcgggtcgagcgggtcgcgccgaagtcccccgccgtcccggccgatgccccggcc
gccctgcggacgcctccggcgtag

DBGET integrated database retrieval system