KEGG   Saccharopolyspora erythraea: SACE_6720Help
Entry
SACE_6720         CDS       T00492                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACE_6720 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACE_6720 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SACE_6720 (phoD)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SACE_6720 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7527310..7528890
Genome map
AA seq 526 aa AA seqDB search
MSDPTNPGPRRAVSRRAVLLGGAAALGASTLGGTSLASALSSPGAGLGRRIADPFTLGVA
SGDPLADGVVLWTRLAPEPTAEDGTGGMPDKVVEVQWEVAEDEAFSRIVQSGEQDAAPDL
GHSVHVELEGLKPGAEYFYRFRAEGSISPVGRTRTAPAPGTMGELTMCFASCAHFGEGYF
TAYRRMAEDEPGLILHLGDYQYEYAAKDSDVRKVLGPETRTLANYRQRHGQYKTDPDLQL
AHSVAPWLVVWDDHEIENNWADETPEKPDDGFLDRRKAAMQAYYENMPLRSGSKPNGIDT
QLYRRYQWGALANFHMLDTRQYRSDQACGDGVQSGCSDREDPNRSLTGAEQEKWLIDGFN
ATSARWDVLGQQVFFSKIDLTPGAEKGYNMDAWDGYVANRDRIAGAMAGSKVRNGVVLTG
DVHRHWAAEIKRTHDDADSPAVGTEFVTTSVTSGGDGNDDGNEDVLGENPHVKFYANRRG
YIRTKFTETQLRADYRVLGQVSKPDAAAETAKSFVVEDGNPTLNPA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcccaccaaccccggtccccgtcgcgcggtgtcccgccgcgccgtcctgctg
ggcggtgccgccgcactgggtgcctcgacgctcggcggcacctcgctcgccagcgccctg
tcctcgccgggcgccggcctcggccgccgcatcgccgacccgttcacgctcggcgtcgcc
tccggcgacccgctggccgacggcgtcgtgctgtggacccgcctcgcgccggagccgacg
gcggaggacggcaccggcggcatgcccgacaaggtcgtcgaggtgcagtgggaggtcgcc
gaggacgaggcgttctcccggatcgtgcagtccggtgagcaggacgccgcgccggacctc
ggccacagcgtgcacgtcgagctggagggcctgaagccgggcgccgagtacttctaccgc
ttccgcgccgagggcagcatctccccggtcggccgcacccgcaccgcgcccgcgccgggc
acgatgggcgagctgacgatgtgcttcgcgtcctgcgcgcacttcggcgagggctacttc
accgcctaccgccggatggccgaggacgagccgggcctgatcctgcacctgggcgactac
cagtacgagtacgccgcgaaggactccgacgtccgcaaggtgctggggccggagacgcgg
accctggccaactaccgccagcgccacggccagtacaagaccgacccggacctccagctc
gcgcactcggtcgcgccgtggctggtggtgtgggacgaccacgagatcgagaacaactgg
gccgacgagacgccggagaagcccgacgacggcttcctcgaccggcgcaaggccgcgatg
caggcctactacgagaacatgccgctgcgcagcggctccaagcccaacggcatcgacacc
cagctctaccgccgctaccagtggggcgcgctggccaacttccacatgctcgacacccgg
cagtaccgcagcgaccaggcctgcggcgacggcgtgcagtccggctgctcggaccgcgag
gacccgaaccgctcgctgaccggtgccgagcaggagaagtggctcatcgacgggttcaac
gccaccagcgcccgctgggacgtgctgggccagcaggtcttcttctccaagatcgacctg
acgcccggtgccgaaaagggctacaacatggacgcttgggacggctacgtcgccaaccgc
gaccggatcgccggggcgatggccgggagcaaggtgcgcaacggcgtcgtgctgaccggt
gacgtgcaccggcactgggcggcggagatcaagcggacccacgacgacgccgactccccc
gccgtgggcaccgagttcgtcaccacgtcggtcaccagcggcggcgacggcaacgacgac
ggcaacgaggacgtgctcggcgagaacccgcacgtgaagttctacgccaaccggcgcggc
tacatccgcacgaagttcaccgagacgcagctgcgcgcggactaccgcgtgctgggccag
gtgagcaagcccgacgcggcggccgagaccgcgaagagcttcgtggtcgaggacggcaac
ccgacgctgaacccggcctga

DBGET integrated database retrieval system