KEGG   Saccharopolyspora erythraea: SACE_6756Help
Entry
SACE_6756         CDS       T00492                                 

Gene name
aceB,mas
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sen  Saccharopolyspora erythraea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_6756 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SACE_6756 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SACE_6756 (aceB)
Enzymes [BR:sen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SACE_6756 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(7562505..7564073)
Genome map
AA seq 522 aa AA seqDB search
MLGGTVERGDEILTKEALEFVAGLQRAFGARRDELLERRKQRRAEAARAGRLDFLEETRE
IREGDWKVAEPPAGIRDRRVEITGPTDRKMSINALNSGARIWLADLEDANTPHWANVVGG
QVNLYDVIRKQVELTTPEGKQYKLRDDVQHAVPLVRPRGWHFDEKHVLVDGKPVVGALLD
FGLYFFHNAKESIERGTGPFFYLPKMESHLEARLWNDVFTKAQADLGVPHGSIRATVLIE
TFPAAFEMEEILYELRDHSAGLNAGRWDYLFSVIKTFRESDSYILPDRNSVTMTAPFMRA
YTELLVRTCHKRGAFAIGGMAAFIPNKKDPEANEKAMQKVHDDKKREAGDGFDGSWVAHP
GLVEICFEEFDAVLGDRPNQIDNVREDVQITADQLLDVASTPGEKTIEGLRAAVDVGVRY
IVSWLGGNGAAAIHNLMEDAATAEISRSQIWQWLHTGVVLAGGQQVTKDLVREVLADTEK
QLRSEEGFPVDDLGRAVELFEQVAVADEFVDFLTLPAYEQID
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggaggcacggtcgagcgcggggacgagatcctcaccaaggaggctctcgagttc
gtcgccggactgcagcgcgctttcggcgcgcgccgcgacgagctgctggaacgccgcaag
cagcgtcgtgccgaggccgctcgcgcgggccgtctcgacttcctggaggagacccgcgag
atccgcgagggcgactggaaggtcgccgagcccccggcgggcatccgcgaccgccgcgtc
gagatcaccggtcccaccgaccgcaagatgtcgatcaacgcgctgaactcgggcgcgcgc
atctggctggccgacctggaggacgccaacaccccgcactgggccaacgtcgtcggcggc
caggtcaacctctacgacgtcatccgcaagcaggtcgagctgaccacgccggagggcaag
cagtacaagctgcgcgacgacgtgcagcacgcggtgccgctggtccgcccgcgcggctgg
cacttcgacgagaagcatgtgctggtcgacggcaagccggtcgtgggcgcgctgctggac
ttcggcctgtacttcttccacaacgccaaggagtccatcgagcggggcaccgggccgttc
ttctacctgccgaagatggagagccacctcgaggcccggctgtggaacgacgtgttcacc
aaggcccaggccgacctcggcgtcccgcacggctcgatccgcgccacggtgctgatcgag
accttcccggccgcgttcgagatggaggagatcctctacgagctgcgcgaccactccgcg
ggcctcaacgcaggccgctgggactacctgttcagcgtcatcaagaccttccgcgagtcc
gactcctacatcctgccggaccgcaactcggtcacgatgaccgcgccgttcatgcgcgcc
tacaccgagctgctggttcgcacctgccacaagcggggcgcgttcgccatcggcggcatg
gcggccttcatccccaacaagaaggaccccgaggccaacgagaaggccatgcagaaggtc
cacgacgacaagaagcgcgaggccggtgacggcttcgacggttcctgggtcgcccacccg
ggcctggtggagatctgcttcgaggagttcgacgcggtgctgggcgacaggcccaaccag
atcgacaacgtccgcgaggacgtccagatcaccgccgaccagctgctcgacgtggcctcc
accccgggtgagaagaccatcgagggcctgcgcgcggcggtggacgtcggcgtccgctac
atcgtgtcctggctgggcggcaacggtgccgcggcgatccacaacctgatggaggacgcc
gcgaccgccgagatctcccgctcgcagatctggcagtggctgcacaccggcgtcgtgctc
gccggcggccagcaggtcaccaaggacctggtcagggaggtcctcgccgacaccgagaag
cagctgcgctcggaggagggtttcccggtcgacgacctcggccgggccgtcgagctgttc
gagcaggtcgcggtggccgacgagttcgtcgacttcctgacgctgcccgcctacgagcag
atcgactga

DBGET integrated database retrieval system