KEGG   Saccharopolyspora erythraea: SACE_6943Help
Entry
SACE_6943         CDS       T00492                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00860  Porphyrin and chlorophyll metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
Module
sen_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACE_6943 (hemB)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SACE_6943 (hemB)
Exosome [BR:sen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SACE_6943 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAM06106
Cambridge: SACE_6943
Kitasato: SACE_6943
UniProt: A4FPY1
Position
complement(7758093..7759073)
Genome map
AA seq 326 aa AA seqDB search
MYPSHRPRRLRKNAAVRRLVSETSVEPRHLVLPMFVREGIAEPMPIPSMPGVVQHTRDSL
RKAAVEAVSAGVGGLMLFGVPAERDAVGSAGTDPDGILNVALRDLSAEVGSDTVLMADLC
LDEFTDHGHCGLLDSEGAVDNDRTLQVYGEMAVVQAESGADVVGPSGMMDGQVGVIRESL
DATGFSDTAVLAYSVKYASAYFGPFRDAVDSQLKGDRKTYQQDPANGREALREADLDLAE
GADMVMVKPAMSYLDVLRDIAGVADVPVAAYQVSGEYSMVEAAVANGWLDRERTVLESLT
SIRRAGADIVLTYWAAEAARWLKAGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgtcgcaccgtccgcgtcggcttcgcaagaacgccgctgtccgccgcctggtc
tcggagacctccgtggaacccaggcatctcgtgctgccgatgttcgtgcgggagggcatc
gccgagccgatgccgatcccatccatgcccggcgtggtgcagcacacccgggactcgctg
cgcaaggccgccgtcgaggcggtgtcggccggagtgggcgggctgatgctgttcggcgtg
cccgccgagcgcgacgccgtcggctcggcgggcacggacccggacggcatcctcaacgtg
gcgctgcgtgacctgtccgccgaggtcggctccgacaccgtgctgatggccgacctgtgc
ctggacgagttcaccgaccacggccactgcggactgctggactccgagggcgccgtcgac
aacgaccggaccctgcaggtctacggcgagatggcggtggtgcaggccgagtccggcgcc
gacgtcgtgggcccgagcgggatgatggacggccaggtcggggtcatccgcgagtcgctg
gacgcgaccggcttctccgacaccgccgtgctcgcctactcggtgaagtacgcgtcggcg
tacttcggcccgttccgcgacgcggtcgactcccagctcaagggcgaccgcaagacctac
cagcaggacccggccaacggccgcgaggcgctgcgcgaggcggacctcgacctggccgag
ggcgccgacatggtcatggtcaagcccgcgatgtcgtacctggacgtgctgcgcgacatc
gctggtgtcgccgacgtgcccgtcgcggcctaccaggtgtccggggagtactcgatggtc
gaggccgcggtcgccaacggctggctggaccgggagcgcaccgtgctggagtcgctgacc
tccatccggcgcgcgggggccgacatcgtcctgacctactgggcggccgaggccgcgcgt
tggctgaaggcgggccggtga

DBGET integrated database retrieval system