KEGG   Saccharopolyspora erythraea: SACE_7136Help
Entry
SACE_7136         CDS       T00492                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sen00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7936712..7938871
Genome map
AA seq 719 aa AA seqDB search
MTDAPGGRGAQDTDRAGARADPAEPDVGPDEHGPDLAELGADLAEPGADLGVAGALHGDE
VADPGGPSAAPGGADGVASTTGGSPSADAHPDDLDTDRGGPGLIEDYALLSDLRTAALVG
RDGSVDWLCLPRFDWPSCFARLLGADHDGHWQIAPVAPVRRVERRYRENSLVLETDFHTD
NGVVRVVDSMPPHEKNHDDQPCLVRMVEGVSGEVAVRMRWVVRFAYGDTTPWVRRVRETD
PVLDEYILAVAGPHTVVLRGDDLPRRVPHQRAHEAVCTVRAGERKSWVMQWSPDPDELPA
PMDPEQETRDSEDFWRTWTRKITYCGPHRDAVYRSLATLKALTYAPTGGIVAAPTASLPE
TLGGDRNWDYRFCWLRDATFVLLALDNFGCQMEAGDWRRWLVRATAGDPRELQIMYGVGG
ERHLLEWEADWLPGYQGAAPVRIGNAAHRQRQLDVYGEVMDALHLARERGLTETPESWAV
QRGMMRHLEQIWRAPDRGLWEVRGPERYFTHSQVMVWVAFDRAVRAIEEDGLPGPLDRWR
GIRDTVRAEVLEHGWNDDVGAFTQYYGGRTLDAATLLLPAVGFLPADDERMRSTVRAIQR
ELQPGGLLVERYSTSDDTSVVGVDGLTGREGAFLACSFWLVDALALGGRRDEAEEMFSKL
VALANDVGLYAEEYDVRSGRFVGNFPQAFTHVALVNSAAVLYGGHARHEASRRDGRGDR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgctcccggtggacgaggcgctcaggacaccgaccgggccggagcacgagca
gatccggccgaacccgatgtcggcccggacgaacacggcccggacctggcagagctcggg
gccgacctcgccgagccgggtgcggacctgggtgtggcgggcgccctgcacggcgacgag
gtcgccgatcccgggggacccagcgccgcgccgggcggcgctgacggcgtcgcaagcacc
accggcgggtcaccgtcggccgatgcgcatcccgacgatctggacaccgatcgcggcggt
ccggggctgatcgaggactacgcgctcctgtcggacctgcggaccgccgccctcgtcggc
agggacggctcggtcgactggctgtgcctgccccgcttcgactggccgtcgtgcttcgcc
cggctgctgggcgccgaccacgacgggcactggcagatcgcccccgtcgcgccggtgcgc
cgcgtggaacgcaggtaccgggagaactccctggtgctggagaccgacttccacaccgac
aacggggtcgtgcgggtcgtcgacagcatgccgccgcacgagaagaaccacgacgaccag
ccgtgcctggtgcggatggtcgagggcgtctccggcgaggtcgcggtccggatgcgctgg
gtcgtgcgcttcgcctacggcgacacgacgccgtgggtgcggcgggtacgggagaccgac
ccggtgctcgacgagtacatcctcgccgtcgccggcccgcacacggtggtactgcgcggc
gacgacctgcccaggcgggtgccgcaccagcgggcgcacgaggcggtctgcaccgtgcgt
gccggcgagcggaagtcgtgggtgatgcagtggtcccccgacccggacgagctgcccgcg
ccgatggaccccgaacaggagacccgcgacagcgaggacttctggcggacgtggacccgc
aagatcacctactgcggtccgcaccgagacgcggtttaccggtcgctggccacgctcaaa
gcgctgacctacgcgccgaccggcgggatcgtcgccgccccgaccgcgtcgctgccggag
acgctgggcggtgaccgcaactgggactaccgcttctgctggcttcgcgacgcgacgttc
gtgctgctggcgctggacaacttcggctgccagatggaagccggggactggcggcggtgg
ctcgtgcgggcgaccgcgggcgacccccgcgagctgcagatcatgtacggcgtcggcggt
gagcggcatctgctggagtgggaggcggactggctgcccggctaccagggcgccgcgccg
gttcggatcggcaacgccgcgcaccggcagcgccagctcgacgtctacggcgaggtgatg
gacgcgctgcacctggccagggagcgcggcctgaccgagacgccggagtcgtgggcggtg
cagcgcggcatgatgcgccacctggaacagatctggcgcgcgcccgaccgcggactgtgg
gaggtgcgcggtccggagcggtacttcacgcactcgcaggtgatggtgtgggtggccttc
gaccgcgcggtgcgcgccatcgaggaggacgggctgccggggccgctggaccgctggcgc
ggcatccgcgacaccgtgcgcgcggaggtgctggagcacggctggaacgacgatgtcggc
gcgttcacgcagtactacggcggccggacgctggacgcggcgacgctgctgctgcccgcc
gtcgggttcctgcccgccgacgacgagcggatgcggagcacggtgcgcgcgatccagcgc
gagttgcagcccggcgggctgctcgtcgagcgctacagcacctcggacgacaccagcgtc
gtgggggtcgacgggctgaccggccgcgagggcgcgttcctggcgtgctcgttctggctg
gtggacgcgctggcgctgggcggacggcgcgacgaggccgaggagatgttctccaagctg
gtcgcgctggccaacgacgtcgggctctacgcagaggagtacgacgtgcgcagcgggcgg
ttcgtcggcaacttcccgcaggcgttcacccacgtcgcgctggtcaactcggcggcggtg
ctctacggcgggcacgcacggcacgaagccagcaggcgcgacggccgcggcgaccgctag

DBGET integrated database retrieval system