KEGG   Saccharopolyspora erythraea: SACE_7138Help
Entry
SACE_7138         CDS       T00492                                 

Definition
lysozyme M1 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7942275..7942982
Genome map
AA seq 235 aa AA seqDB search
MSNQADDAEMGSQIRKHEGGDPEAAPQDVDAQATVAGIDVSGHQRNVDWQYWWNQGKRFA
YVKATEGTGYKNPYFAQQYNGSYNIGMIRGAYHFALPDRSSGAAQANYFVDNGGGWSKDG
KTLPGALDMEYNPYGGTCYGKTPAQMTAWIKDFSDTYHARTGRWPVIYTSTSWWSSCVNG
DFSSTNPLWVARYASTVGKLPYNWGFHTIWQYTSSPIDQNSFNGGYDRLQALANG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccaggcagacgacgccgagatgggctcacagatccgtaagcacgaaggcgga
gacccagaggcggccccgcaggacgtcgacgcgcaggcgaccgtggctggcatcgacgtc
agcggccaccagaggaacgtcgactggcagtactggtggaaccagggcaagcgcttcgcc
tacgtcaaggcgaccgagggcacgggctacaagaacccgtacttcgcccagcagtacaac
ggctcctacaacatcgggatgatccgcggcgcataccacttcgcgctgccggaccgctcc
agcggcgcggcccaggccaactacttcgtcgacaacggcggcggctggtccaaggacggc
aagacgctgcccggcgcgctggacatggagtacaacccctacggcggcacctgctacggc
aagacgcccgcgcagatgaccgcgtggatcaaggacttcagcgacacctaccacgcccgc
accgggcgctggcccgtcatctacaccagcaccagctggtggagctcgtgcgtcaacggc
gacttcagctcgaccaacccgctgtgggtcgcccgctacgccagcacggtgggcaagctg
ccgtacaactggggcttccacaccatctggcagtacacctcgtcaccgatcgaccagaac
tccttcaacggcgggtacgaccgcctgcaggcactggccaacggctga

DBGET integrated database retrieval system