KEGG   Saccharopolyspora erythraea: SACE_7169Help
Entry
SACE_7169         CDS       T00492                                 

Gene name
glpQ
Definition
glycerophosphoryl diester phosphodiesterase (EC:3.1.4.46)
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SACE_7169 (glpQ)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     SACE_7169 (glpQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7973111..7974214
Genome map
AA seq 367 aa AA seqDB search
MIRARLTALAVAGAAVLGTVVQLPASAAPSQPGDRIEVFGHRGASGYRPEHTLASYELAA
RMGADYIEPDLVPTKDGVLVSRHENEISGTTDVARRPEFADRRTTKVIDGQELTGWFTED
FTLAELKTLRAVERIPDIRPNNTVYDGRWQVPTFQEVLDLRARLSKELGREIGVAPETKH
PSYFARIGLPLEPGVVQTLDRNGLNKRQAKVVVQSFEVGNLKRLDESLEVGLVQLISNSG
APQDFVEAGDPRTYADLVKPEGLREIAGYADVIGPDTKVVLPVDDQGRLTEPTTVVADAH
AAGLQVVPYTVRAENHFLPADFRSSDVPSAYGDVFGFYAALFAQDIDGIFADHPDTAVIA
RDEHAGR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggcacgtctgacggcgctggccgtcgcgggagccgcggtgctgggcacggtg
gtccagcttcccgcgagcgcggccccctcccagccgggcgaccgcatcgaggtcttcggg
caccgcggcgcctccgggtaccgccccgagcacaccctcgcctcctacgagctggcggcc
cggatgggcgccgactacatcgagcccgacctggtgcccaccaaggacggcgtgctggtg
tcccggcacgagaacgagatcagcggcaccaccgacgtcgcccggcgcccggagttcgcc
gaccgccggaccaccaaggtcatcgacggccaggagctgaccggctggttcaccgaggac
ttcacgctggcggagctcaagacgctgcgcgccgtcgagcgcatccccgacatccgcccc
aacaacaccgtctacgacggccgctggcaggtgcccacgttccaggaggtgctggacctg
cgggcccggctgtccaaggagctgggccgcgagatcggcgtcgcgcccgagaccaagcac
cccagctacttcgcccgaatcggcctgccgctggagccgggcgtggtgcagaccctcgac
cgcaacgggctgaacaagcggcaggcgaaggtcgtggtgcagtccttcgaggtgggcaac
ctcaagcggctcgacgagtcgctggaggtggggctggtccagctcatcagcaacagcggc
gcgccgcaggacttcgtcgaggccggggacccgcgcacctacgccgacctggtcaagccc
gaggggctgcgggagatcgcgggctacgccgacgtcatcggcccggacaccaaggtggtc
ctgccggtcgacgaccagggccggctcaccgagccgaccaccgtcgtcgccgacgcccac
gcggcgggcctgcaggtcgtgccgtacacggtgcgcgccgagaaccacttcctgcccgcg
gacttccgctcctcggacgtgccgtcggcctacggcgacgtgttcggcttctacgccgcg
ctgttcgcccaggacatcgacggcatcttcgccgaccacccggacaccgccgtcatcgcg
cgcgacgagcacgccgggcgctga

DBGET integrated database retrieval system