KEGG   Saccharopolyspora erythraea: SACE_7183Help
Entry
SACE_7183         CDS       T00492                                 

Gene name
nagC4
Definition
transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_7183 (nagC4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_7183 (nagC4)
   00052 Galactose metabolism
    SACE_7183 (nagC4)
   00500 Starch and sucrose metabolism
    SACE_7183 (nagC4)
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_7183 (nagC4)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SACE_7183 (nagC4)
   00524 Butirosin and neomycin biosynthesis
    SACE_7183 (nagC4)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SACE_7183 (nagC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
7986918..7987838
Genome map
AA seq 306 aa AA seqDB search
MTSHAIAVDVGGTEMKAALVAVEPGAARTLRQTRRRTPRGADGPSTAESVIDAVAEIVAE
LRADADADAIGVVVPGIVDEQRGMGVYSANLGWREEPLRDKLAARFDLPLAFGHDVRAGG
LAEARLGAARGMRDVIVMPIGTGIAAALVFNGQIYSAGGHAGEIGHVDIGHGEPCPCGGT
GCVEAVASSAAVARRYTARVGTPVDGAAAVADAVRAGDPHAAAVWQEAVDALARGLVTLT
AVLAPEGIVLGGGLAMAGRLLTDPLAARLDEMLLPFHRRPRLELAELGDTAGCLGAALLA
TEGLQR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcacatgcgatcgccgtcgacgtcggcggtaccgagatgaaggccgcgctggtg
gccgtcgagcccggcgccgcgcggacgctgcggcagacccggcggcggaccccgcgcggt
gccgacggcccttccaccgccgagagcgtgatcgacgcggtcgccgagatcgtggcggag
ctgcgcgccgacgcggacgccgacgccatcggcgtcgtcgtgcccggcatcgtcgacgag
cagcggggcatgggcgtctactcggccaacctggggtggcgggaggaaccgctgcgcgac
aagctggcggcccgcttcgacctgccgctggccttcggccacgacgtccgggcgggcggc
ctggccgaggcccgcctcggcgcggcgcgcggcatgcgcgacgtgatcgtgatgcccatc
ggcaccggcatcgccgccgccctggtcttcaacggccagatctactccgcgggcgggcac
gcgggcgaaatcggccacgtcgacatcgggcacggcgagccgtgcccctgcggcggcacc
ggctgcgtggaggcggtcgcgtcctcggccgccgtcgcccgccgctacaccgcgcgcgtc
ggcaccccggtcgacggagccgccgcggtcgccgacgccgtccgcgcgggcgacccgcac
gccgccgcggtgtggcaggaggcggtcgacgcgctggccagggggctggtgacgctgacg
gcggtgctcgcgccggagggcatcgtgctgggcggcgggctggcgatggcgggccggctg
ctcaccgacccgctggccgcgcggctggacgagatgctgctgccgttccaccgcaggccg
cggctggaactggcggaactgggtgacacggcaggctgcctgggcgcggcactgctggcg
acggaagggttgcaacggtga

DBGET integrated database retrieval system