KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_15670Help
Entry
BN855_15670       CDS       T02827                                 

Gene name
SBOV15291
Definition
thermolabile glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN855_15670 (SBOV15291)
   00330 Arginine and proline metabolism
    BN855_15670 (SBOV15291)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BN855_15670 (SBOV15291)
Enzymes [BR:senb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BN855_15670 (SBOV15291)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1545125..1546039
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGLGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagagacgattttacaacgcgttcgccccctcattggcctgggc
aaagtcgctgactatattccggcattagcgtccgtcgagggttcaaagctggggatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgcttagtctggtggtggcgatgcgtcattatccggaagaggag
atctggcagcgcgtcggaaaagacccttccggctcgccattcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaagggcggcttagcgcgccgcgtcagcgaatgctggaagttgtgcgcgcg
ctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgttctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattacttccactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagtgacccccatgcaggcccggcagattaatgcgctaatggcgaccagcgggatgtat
cagaatgccggagagtttgcctggcgggtgggattgccagctaaatccggcgtgggcggc
ggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaacacaaacgttagga
cgttcggtatactga

DBGET integrated database retrieval system