KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_18030Help
Entry
BN855_18030       CDS       T02827                                 

Gene name
SBOV17691
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:senb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN855_18030 (SBOV17691)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN855_18030 (SBOV17691)
   00620 Pyruvate metabolism
    BN855_18030 (SBOV17691)
   00650 Butanoate metabolism
    BN855_18030 (SBOV17691)
  Lipid metabolism
   00071 Fatty acid degradation
    BN855_18030 (SBOV17691)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN855_18030 (SBOV17691)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN855_18030 (SBOV17691)
   00626 Naphthalene degradation
    BN855_18030 (SBOV17691)
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN855_18030 (SBOV17691)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN855_18030 (SBOV17691)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1785375..1788053
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQNVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGEVAAKKDVVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggtcgacaaaatcttccgcgccgccgctctg
gcagcagctgatgcccgcattccgctggccaaaatggccgtcgccgaatccggtatgggt
atcgtggaagacaaagtgattaaaaaccacttcgcttctgaatatatttacaatgcctat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcgggaccatcaccatt
gctgaacctatcggcattatttgcggtatcgttccaaccactaacccaacctctaccgcg
atcttcaaatcgctgattagcctgaagacccgtaacgccatcatcttttctccgcatccg
cgcgctaaagaagcaaccaacaaagcggcagacatcgttctgcaagcggctatcgctgcc
ggcgcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaatgcg
ctgatgcaccacccggatatcaacctgatcctcgccactggcggtccaggcatggttaaa
gcagcatacagctccggtaaacctgctatcggcgtaggcgcaggcaacaccccggttgtc
attgatgaaaccgcggatatcaaacgcgctgtggcgtctgttctgatgtctaaaaccttc
gataacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctatgat
gccgttcgcgaacgtttcgccagccatggcggctacatgctgcagggccaggagctgaaa
gcggttcaaaacgttatcctgaaaaatggcgctctgaacgccgctatcgtcggccagcca
gcctacaaaatcgctgaactggcaggcttctccgtaccagaaaccaccaagattctgatc
ggtgaagttacggtcgttgacgaaagcgaaccgttcgcacacgaaaaactgtctccgact
ctggcgatgtatcgtgcgaaagatttcgaagaagcggtagaaaaagcagaaaaactggtc
gctatgggcggtatcggtcacacctcctgcctgtacactgaccaggataaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgacgttgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgcccatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaacggctacgcagaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagccgacccg
acgctttccgttgttcgcaaaggcgctgagctggctaactccttcaaaccagacgtgatc
atcgcgctgggcggtggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatat
ccgctggctgactacgccctgaccccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggtcaggctctgcaggctctgaaa
ctgctgaaagaaaacctgccggcgtcttaccacgaagggtctaaaaacccggttgcgcgt
gaacgtgttcacagtgcagcgactatcgccggtatcgcgtttgccaacgccttcctcggt
gtatgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcag
accgctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgac
cacctgggcctgagcgcgccgggcgaccgtaccgccgctaagattgaaaaactgctggca
tggctggaaagcattaaagctgagctgggtatccctaagtctatccgtgaagcaggcgta
caggaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccag
tgcaccggcgctaacccgcgttatccactgatctccgaactgaaacagattctgctggat
acctactacggtcgtgatttcaccgaaggtgaagttgcagcgaagaaagacgtcgttgcc
gcaccgaaagcagagaaaaaagcgaaaaaatccgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system