KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_3130Help
Entry
BN855_3130        CDS       T02827                                 

Gene name
SBOV02661
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:senb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:senb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
331230..332333
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagctacacgcc
gcgggacatcgtattgttattgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacgatcgcctctaaacagcttctggcggcggtagggcaa
agccgcctgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgcgatacg
ctacgtgcattactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgataacgataacctctccgcgctggcggctatcctggca
ggcgcggataaactgctgctgctgaccgatcagcaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
atcgcgggagacagcgtttccgggctgggaaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgtcgcgcgggtattgatacgattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggagaaccgcaaacgttggatcttcggcgcgccgccggcaggtgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatattgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattctgggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

DBGET integrated database retrieval system