KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_37510Help
Entry
BN855_37510       CDS       T02827                                 

Gene name
SBOV37481
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN855_37510 (SBOV37481)
Enzymes [BR:senb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN855_37510 (SBOV37481)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3721061..3723088
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPATGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
REWKQTNPDKALDNSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcaacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccagatgttgtcgttaaaaccctgcgaaggcgcgccgccg
caatggcgtttgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgaacgcaccgcgcagctcgcctaccag
tgtcccgtctgggatggttcgccgctcacgctggatgttcgccagacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcgtcg
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaatgaccacagctatggtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttacgcgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
ggaacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcagcgaagccgatctccgcgcgctggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagttcggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgaccggccaccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggtctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgaaggctatacgccacgggattatctg
actcactggttaagccagtgggtgcatgattacggcattgacgggttccgggtcgatact
gccaaaaacgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
cgtgaatggaagcagaccaatccggacaaagcgctggataatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatggcggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccgggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

DBGET integrated database retrieval system