KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_7570Help
Entry
BN855_7570        CDS       T02827                                 

Gene name
SBOV07181
Definition
acyl-CoA thioester hydrolase YbgC
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN855_7570 (SBOV07181)
   00500 Starch and sucrose metabolism
    BN855_7570 (SBOV07181)
Enzymes [BR:senb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BN855_7570 (SBOV07181)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(792463..793434)
Genome map
AA seq 323 aa AA seqDB search
MVKRTNKRQYIAIMPGDYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRR
AVNPGGKYMPGKPAWYMFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVD
AGNHPAVALRTDGDKVQINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDV
DMVSGRGAVVFDNTNFQVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLG
RSLDVDANTNGQVVIRDSVINEGFNVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDT
NYNRMWEYNNRGVGSKVVAEPKQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacgcacgaacaaacgccagtacattgctattatgccgggcgactatcagggg
accgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggaccggtgaaaaaccg
atcgatgtgaaaattgggatggcgattgatggtgaaatgagcgtcgctgactggcgccgc
gcggtgaatcccggcgggaaatatatgcctggtaaacccgcctggtatatgttcgataac
tgccaaagcaaacacgccgcgacgatcggtgtgatgtgttctgccgcgttctggtcgcag
aataacggtctgcagctacaaaatctgaccatcgagaacacgctaggcgacagcgtcgat
gccggaaaccatccggcggtggcgttgcgtaccgatggcgacaaagtccagattaacaag
gtcaatatccttggccgccagaacaccttctttgtgaccaacagcggcgtgcagaaccgt
ctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatattgaaggcgatgtg
gatatggtttccggacgcggcgccgtggtgttcgataacaccaacttccaggtcgtcaac
tcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtccaatatttactat
ggctttttggcgatcaacagccgctttaacgcctccggcgatggcgttgcgcagcttggc
cgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgcgacagcgtgatt
aacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatctcgaaacgtccgttt
gctggaaatacggggaccgtggatgacaaagacgaggtgcagcgtaatctgaacgacact
aactacaaccgcatgtgggaatacaacaaccgcggtgttggcagtaaagtggtggcggaa
cctaagcagtaa

DBGET integrated database retrieval system