KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_01951Help
Entry
DT104_01951       CDS       T02874                                 

Gene name
mrcB
Definition
penicillin-binding protein 1b; peptidoglycan synthetase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:send00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DT104_01951 (mrcB)
Enzymes [BR:send01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DT104_01951 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     DT104_01951 (mrcB)
Glycosyltransferases [BR:send01003]
 Polysaccharide
  Bacterial polysaccharide
   DT104_01951 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
220927..223449
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPV
WTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaggggaaaccgtcacgtcctgtgaaa
caaaaggtgagccgtcgtcggcagcatgacgacgattatgatgatgactatgaggatgaa
gaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctgtggctattgctaaaactgtttatcgtttttgtggtgctgttcgccatttacggcgtc
tatctggatcaaaaaatccgcagccgtatcgatggcaaggtctggcagcttccggcggcg
gtatatggccggatggtgaaccttgagccagacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacgaagatgacccgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaagggcaggtgcgcgcgcggctgacgttcagtgacgggcgtctggaaaccatcgtcaat
ctggataacaaccgccagtttggcttcttccgtctcgatccgcggcttatcaccatgctt
tcttcgccaaatggcgagcagcgtttattcgtcccgcgcagcggtttcccggatctgctg
gtcgatacgctgttggcgacggaagaccgtcatttctatgagcatgatggcattagtctt
tactctatcgggcgtgcggtgctggccaacctgacggcgggacgcacggtgcagggggcc
agtacgctgacccagcagctggtgaagaacctgttcctctccagcgaaagatcatactgg
cgtaaagcgaatgaagcctacatggcgctgatcatggatgcccgttacagtaaagatcgt
attcttgagctgtacatgaacgaggtctacctcggtcaaagcggggacaatgaaattcgc
ggttttccgctggcgagcctgtattactttggtcgtccggtagaggaactgagcctcgat
cagcaggcgttactggtggggatggtaaaaggggcgtcgatttataacccgtggcgtaac
ccgaaactggcgttggagcgtcgtaacctggtgttacgcctgttacagcagcagaaaatc
atcgatcaggaactctatgacatgctgagcgcgcgtccgcttggcgtacagccgcgcggc
ggcgttatttcaccgcagccagcgtttatgcagatggttcgtcaggaactgcaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagatcttcaccacctttgactccgtg
gcgcaggatgccgcagaaaaagccgttgtcgaaggtattccggcgttgaagaagcagcgt
aaattgagcgatctggaaaccgcgatggtggtggtggatcgctttagcggcgaggtgcgc
gcgatggttggcggggcggagccgcagtatgccggctataaccgtgccatgcaggcgcgc
cgttccatcgggtcgctggcgaaaccggcgacctatctgaccgcgttaagtcagccgaac
ttataccgtctgaacacctggattgccgatgcgccgatttctctgcgccagccgaatggt
caggtctggtcgccgcagaacgacgatcgtcgctacagcgaaagcgggaaagtgatgctg
gtggatgcgttaactcgctcaatgaacgtaccgacggtcaatctggggatggcgttaggt
ttaccggcggtaaccgatacctggacgaagctcggcgtgccgaaagatcagctcaatccg
gttccggctatgctgttaggagcgctgaacctgacgccgatcgaagtggcgcaggcgttc
cagactatcgccagcggcggaaatcgcgcgccgttatcagcgctgcgttcagttattgcg
gaagatggtaaagtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtggtacggggcgtcag
cttggcgcgaaatatccgggtctgcatctggccggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgacggcagccaggtgactatcacctgggtaggccgt
gataacaaccagccgacgaaattgtacggcgccagcggcgcgatggcgatttaccagcgc
tatctggcgaaccagacgccgacgcctttagttctgacgccgccggaagatgtggtggat
atgggcgttgattacgacggtaattttgtctgtagcggcggtatgcgcactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcaacagcagcag
ccgtcaggcaatccgttcgatcagtcgtctcagccgcagcagcctgcgcagcaacagccg
ccgaaagaagagaagagcgacggcgttgccggctggattaaggagatgttcggcggcaat
taa

DBGET integrated database retrieval system