KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_19751Help
Entry
DT104_19751       CDS       T02874                                 

Gene name
amyA
Definition
cytoplasmic alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:send00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DT104_19751 (amyA)
Enzymes [BR:send01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DT104_19751 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2079147..2080631
Genome map
AA seq 494 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWSELAERADGLNDIGINMVWLPPACKGASGGYSVGYDTYD
LFDLGEFDQKGTIATKYGDKRQLLTAIDALKKNNIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQAVAPKPLFIVAEYWSHEVDKLQTYIDQVDGKTMLFDAPLQMKFHEAS
RQGAEYDMRHIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGASYEDSGENGETCRVDMPVINQLDRLILARQRFAHGIQTLFFDHPNCI
AFSRSGTEENPGCVVVLSNGDDGEKTLLLGDNYANKTWRDFLGNRDEYVVTNDQGEATFF
CNAGSVSVWVIEDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttattgcagtacttccactggtattatcccgacggcggtaaactc
tggtctgagctggcggaacgtgctgatgggctgaatgatatcggtatcaatatggtctgg
ctaccgcccgcctgtaaaggcgcctccggcggctattccgtaggctatgatacctacgac
ctgtttgacctcggcgaatttgaccaaaaaggaactatcgcgacaaagtacggcgataaa
cgccagttactgacggcgatagacgcgctcaaaaaaaataatattgcggtgctgctcgac
gtcgtcgtgaaccacaaaatgggcgcagacgaaaaagaacgtattcgcgttcagcgcgtg
aatcaggatgaccgcacgcaaatcgatgacaacatcattgaatgcgaaggctggacgcgc
tacaccttccctgcccgcgcgggccagtattccaactttatttgggactatcactgtttc
agcggcattgatcacatcgagaatcccgacgaagacggcatttttaagatcgtcaatgac
tataccggcgatggctggaacgatcaggttgatgatgagatgggtaatttcgactatctg
atgggtgaaaatatcgattttcgcaatcatgcggttacggaagagattaaatattgggct
cgttgggtcatggaacaaacccactgtgacggctttcgcctggacgcggtaaaacatata
cccgcctggttttataaagaatggattgagcatgtacaggcggttgcgccaaaaccgctg
tttattgtcgcagaatactggtcgcatgaagtggataaactgcaaacgtacatcgatcag
gtcgacgggaaaaccatgctgttcgacgcgccgttgcagatgaaatttcacgaggcctcg
cgccagggcgcggagtatgacatgcgccacattttcaccggcacgctggtagaagccgac
ccttttcatgcggtgacgctggtcgctaaccacgatacacaaccgttacaggcgctggaa
gcgccggtagaaccctggttcaaaccattggcctatgcgctgatcctgcttcgtgaaaac
ggcgtgccgtcagtgttttatcccgatttatacggcgccagctatgaggatagcggcgaa
aatggcgagacctgtcgggtcgacatgccggtgattaaccaactggatcggctgatcctc
gctcgtcagcgttttgcacacggtatacaaacactctttttcgatcatcctaactgtatc
gcctttagtcgcagcggtactgaagagaatccaggctgtgtggtcgtactttccaatggc
gacgacggtgaaaaaaccctcctgctcggcgacaattacgctaacaagacctggcgtgat
tttctgggaaaccgggatgagtatgttgtaactaatgatcaaggcgaagcgacgttcttc
tgcaacgcaggcagcgtcagcgtgtgggtcattgaggacgtgtga

DBGET integrated database retrieval system