KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_13330Help
Entry
IA1_13330         CDS       T02868                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sene00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    IA1_13330
   00650 Butanoate metabolism
    IA1_13330
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IA1_13330
   00280 Valine, leucine and isoleucine degradation
    IA1_13330
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IA1_13330
Enzymes [BR:sene01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     IA1_13330
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     IA1_13330
Amino acid related enzymes [BR:sene01007]
 Aminotransferase (transaminase)
  Class III
   IA1_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2794806..2796089
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVARAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggg
cagattcacccaattttcgccgagcgggcggaaaattgtcgggtctgggatgtcgaaggc
cgtgagtatctcgatttcgcaggcggcattgccgtcctgaacaccggtcatttacatccg
ggcattgtttctgcggtggaagcgcagttgaagaaattgtcgcatacctgttttcaggtg
ctggcctatgaaccgtatctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgactggttcagaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcgacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacatcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaatcta
ctgcaaaaggcgaatacgcttggcaaaacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggtgacgtgcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtggcccgcgcc
cgcgagaaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccagtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system