KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_02415Help
Entry
CFSAN002069_02415 CDS       T02735                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00380  Tryptophan metabolism
senh00630  Glyoxylate and dicarboxylate metabolism
senh01110  Biosynthesis of secondary metabolites
senh01130  Biosynthesis of antibiotics
senh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:senh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN002069_02415 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CFSAN002069_02415 (katE)
Enzymes [BR:senh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CFSAN002069_02415 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGQ76617
Position
complement(1876723..1878975)
Genome map
AA seq 750 aa AA seqDB search
MSHNEKSPHQSPVHDTRESQPGLDSLAPSDGSHRPTPEPTPPGAQPTAPGSLKAPETAND
KLTALDAFRKGSENYALTTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIP
ERIVHARGSAAHGYFQPYKDLSDITKAAFLCDPQKITPVFVRFSTVQGGAGSADTVRDIR
GFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYV
SLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAQGKATFVRFHWKPLAGKASLV
WDESQKLTGRDPDFHRRDLWEAIEAGDFPEYELGLQLIAEEDEFKFDFDLLDPTKLIPEE
LVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGIDFTNDPLLQGRLFSYTDTQISRL
GGPNFHEIPINRPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAPKRGGFE
SYQERVDGNKIRERSPSFGEYYAHPRLFWLSQTPIEQQHIIDAFSFELGKVARAYIRERV
VDQLAHIDVTLAQGVAHNLGFALTHEQTQIAPPPDVNGLKKDPALSLYAVPDGDVKGRVV
AILLNDKVNAADLLTILQALKAKGVHAKLLYSRMGEVTADDGSTLTIAATFAGAPSLTVD
AVIVPCGNIADIESCGDARYYLLEAYKHLKPIALAGDARRFKALLNIDSQGEEGLVEADN
VDHHFMDTLLTLMAAHRVWSRAGKINAIPA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataatgagaaatccccccatcagtcccccgtgcatgatacccgtgaatcacag
cccggcctggactccctggcgccgtcagacggttcacatcgccccacgccagaaccgacg
ccgccaggcgcgcaaccgacggcccccggcagcttaaaagcgcccgagaccgcgaatgat
aagctcactgccctcgacgcctttcgtaaaggcagcgaaaattatgcgctgaccaccaat
cagggcgtgcgcatcgccgacgatcaaaattctcttcgcgccggcagccgtggccctacg
ctgttggaagattttatcctgcgcgagaaaattacccactttgaccatgagcgtatcccg
gagaggatcgttcacgcccgcggatctgcagcgcacggctattttcagccatataaagac
ctgagcgacatcacgaaagccgcgtttctgtgcgatccacagaaaattaccccggtcttt
gttcgcttttcgacagtacagggcggcgcggggtctgctgataccgtacgtgatatccgc
ggttttgcgaccaaattttataccgaagagggaattttcgatctcgtcggtaataacacg
ccgatcttttttatccaggatgcgcataagtttccggattttgtgcacgccgttaagccc
gaaccacattgggctattccgcaaggacagagcgcgcacgacaccttctgggactatgtt
tccttacagcctgagacgctgcacaacgtcatgtgggcaatgtcggatcgcggtattcca
cgcagttatcggacgatggaagggttcggcattcacaccttccgtctgatcaatgcgcaa
gggaaagcgacctttgtccgtttccactggaaaccgttggcgggtaaagcctcgctggta
tgggatgagtcacaaaaactgaccggtcgcgatccggattttcaccgccgggatctgtgg
gaggccatcgaagcgggcgatttcccggaatacgagctgggcctacaactcattgccgaa
gaggatgaatttaaattcgattttgatctgctcgatccgaccaaactgattccggaagag
ttggtgccagtacaacgcgtcggcaaaatggtgttaaaccgtaatccggataactttttc
gctgaaaacgaacaggcggcatttcatccagggcatattgttcccggcattgattttacc
aacgatccgctgttacaggggcgcctgttctcttataccgacacgcaaatcagccgcctg
ggcgggccaaacttccacgaaattccgattaaccgccctacctgcccctaccataacttc
cagcgtgacggtatgcaccggatggatatcgacaccaatccggcgaactatgaaccgaac
tccattaatgacaactggccgcgcgaaacgccgccagcgccaaaacgcggcggcttcgaa
tcataccaagaacgcgtggatggcaataaaatccgcgaacgcagcccctctttcggtgaa
tattacgcgcatcctcgcctgttctggctcagtcagacgccgatagagcagcagcatatt
attgacgcgttcagctttgaactgggtaaagtcgctcgcgcgtatattcgggagcgggtg
gtcgatcagttagcgcatattgatgtcacgctggctcagggcgtcgcgcataatctcggt
tttgcactcacccatgagcaaacgcaaattgccccgcctcctgatgtcaacggtctgaaa
aaagatccggcgctcagcctgtatgcggtgccagacggcgatgttaaaggtcgcgtggtc
gctattctgctgaacgacaaggttaacgccgccgatctgctgaccattttgcaggcttta
aaagccaaaggcgtccacgcaaaactgctctattcacggatgggtgaagtaacggctgat
gacggttcaacattaacgattgcggcaacctttgccggcgcgccgtcgctaacggtcgat
gcggtaatagtaccgtgcggcaatattgccgatatcgagagttgcggcgatgcccgctac
taccttctggaagcctacaaacatctgaagcccatcgcactggcaggcgacgcccgacgg
tttaaggcgcttttaaacattgatagccagggggaagaaggacttgttgaggcagataac
gttgaccaccactttatggacactctgctgacgctgatggcggcacaccgtgtctggtcg
cgtgcggggaaaattaacgcgattcctgcataa

DBGET integrated database retrieval system