KEGG   Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069: CFSAN002069_09360Help
Entry
CFSAN002069_09360 CDS       T02735                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
senh  Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:senh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1924714..1926036)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttattaatggtattcgtgacaatactatctctgaagggcagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgtccttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtaggggacgtgacgtctctgatgttggggcca
atggtagcggcctgcggcggttatgtgccgatgatctccggtcgcggcctcggacatacc
ggcggtacgctcgacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgtttccgcgaaattattcaagacgtgggtgtggcgattattgggcaaaccagctcgctt
gcaccggcggacaaacgtttttacgccacccgcgatattaccgcgacggtggactctatt
ccgctgatcaccggctccatcctcgccaagaaactggccgaagggcttgatgcgctggta
atggacgtaaaagtcggcagcggcgcgtttatgccaacctatgaactttctgaagccctt
gctgaagcgattgtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcttgtttgacgtcactatggcgctatgc
gtggagatgctgatctccggccagctggcgaaagacgacgccgaagcgcgtgccaaactg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccaagcgatttcgttgagaactacgataaatacttgccgaccgccatgttgagc
aaagcggtatatgctgataccgaagggtttatcagcgcaatggatacgcgtgcgctgggg
atggcggtcgtctcgatgggcggcggccgtcgtcaggcgtctgacaccattgattacagc
gttggctttaccgacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcg
gtgattcatgccaaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggca
attatccttgacgataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaa
tag

DBGET integrated database retrieval system