KEGG   Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069: CFSAN002069_13720Help
Entry
CFSAN002069_13720 CDS       T02735                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
senh  Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFSAN002069_13720 (malS)
Enzymes [BR:senh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CFSAN002069_13720 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2855075..2857102)
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPKRTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPTTGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
REWKQANPDKALDNSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcgacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccaaatgttgtcgttaaaaccctgcgaaggcgcgccaccg
caatggcgtttgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctaaacgcaccgcgcagctcgcctaccag
tgtcccgtctgggatggttcgccgctcacgctggatgttcgccagacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcgtca
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaatgaccacagctatggtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttgcgtgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
gggacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acactggatgccaacatgggcagcgaagccgatctccgcgcactggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagttcggcgcgctctatttatctggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgacccaccaccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggtctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgaaggctatacgccacgggattatctg
actcactggttaagccagtgggtgcatgattacggcattgacgggttccgggtcgatact
gccaaaaacgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
cgtgaatggaagcaggccaatccggacaaagcgctggataatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
ggaccagtctggcagcagatggcggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccgggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

DBGET integrated database retrieval system