KEGG   Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069: CFSAN002069_14490Help
Entry
CFSAN002069_14490 CDS       T02735                                 

Definition
glycogen-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
senh  Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:senh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3031454..3033640
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTPGEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVTRPPETGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLNLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactagaagtccgcgccctctta
cctgacgccaccgacgtatgggtgattgagcccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtgacctggcacggacagcagaacctcatcgacgatccttaccgt
tttggtccattaatacaggaaatggatgcctggctattgtcggaaggcacccacctgcgt
ccttatgaaacgctgggcgcgcacgccgatacgatggatggcgtcaccggcacccgtttc
tccgtctgggcgcctaatgctcgtcgcgtttcggttgtcgggcaattcaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatggacaactgtataaattcgagctgcttgatgcgaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcgcagatgcgtccggaaacggcgtcgatgatt
tgcggactgccggagaaagtgacgccaggcgaagaacgacaaaaagccaatcagtttgat
gcgccgatctcgatttatgaggtgcatttaggttcatggcgccgccatacggataacaat
ttctggctgagctatcgtgagctggcggatcagcttgtgccttacgccaaatggatgggc
tttactcaccttgaactcttgccggtcaacgaacatccgtttgacggcagttggggctac
cagccgaccggcctctacgcgccgacccgccgctttggtacgcgagacgacttccgttat
ttcatcaatgcggcccatgcggcgggccttaacgtcattctcgactgggtgccgggccat
ttcccgtccgatgaatttagcctcgcggagtttgacggcacccacctctatgagcacagc
gacccgcgcgagggctatcaccaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaattatctggtgggtaacgccctgtactggatggagcgttttgggattgat
gcgctgcgtgtcgatgcggtggcctctatgatctaccgcgactacagccgcaaagagggc
gagtggataccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttctctggcgtgacgcgtccaccggaaacgggtgggctggggttctggtacaag
tggaatctgggctggatgcacgacacgctggactacatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaactttgtt
ctgccgctgtcgcacgatgaggtggttcacggcaagaaatccattctcgatcgtatgccg
ggcgatgcgtggcaaaaattcgccaacctgcgcgcctattatggttggatgtgggccttc
cccggcaagaaactgctgtttatggggaatgagtttgcccagggacgcgagtggaaccat
gacgccagcctcgactggcacctgctggaggggggcgataactggcaccacggggttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaagcgttgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgacaatgaacgctcggtactgatt
tttgtacgccgtgataaagccggtaacgagatcatcgtcgccagcaactttacgcccgtt
cctcgccacgactaccgctttggcatcaaccagccgggacgctggcgtgaaattctcaat
actgattcgatgcattatcacggtagcaacaccggcaatggcggcgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttaacctgacgttaccgccgttggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system