KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_00395Help
Entry
CFSAN001992_00395 CDS       T02479                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFSAN001992_00395 (folE)
Enzymes [BR:senj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CFSAN001992_00395 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
47830..48498
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatctcgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgttgacgagattttcgccggcctcgac
tacgccaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcacttcgtgaccattgatggc
aaagcgactgtcgcgtatatccccaaagattccgtgatcggcctgtcgaaaattaaccgt
atcgtgcaattcttcgcccagcgtccgcaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacatcgctg
ggcggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgccat
catccatga

DBGET integrated database retrieval system