KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_02710Help
Entry
CFSAN001992_02710 CDS       T02479                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:senj00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
506161..506778
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDALEEGSLTAIQERHRHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctg
caatcttcatacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatc
gacgatcgtttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaa
ttgtttaaccaaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagaca
atacattgcgtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaatta
tccgaggttgtcgacaaattagatattccagtactctgctatgggctacgaacagacttt
cgtggggagctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaa
ttaaaaactatctgtttctgcggtcgtaaagccagtatggttctgcgacttgatcaggac
ggcaggccttataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttca
gtttgccgtaagcattataaggacgcgctggaggagggctcactgacggcgattcaggag
cgtcatcggcacatatga

DBGET integrated database retrieval system