KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_11195Help
Entry
CFSAN001992_11195 CDS       T02479                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CFSAN001992_11195 (deoA)
Enzymes [BR:senj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CFSAN001992_11195 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2257193..2258515)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDETSWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggtattcgtgacaatactatctctgaagggcagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgtccttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtaggggacgtgacgtctctgatgctggggcca
atggtagcggcctgcggcggttatgtaccgatgatctccggtcgcggcctcggacatacc
ggcggtacgctcgataaactggaagcgatcccgggcttcgacatcttcccggacgacaac
cgtttccgcgaaattattcaagacgtgggtgtggcgattattgggcaaaccagctcgctt
gcaccggcggacaaacgtttttacgccacccgcgatattaccgcgacggtggactctatt
ccgctgatcactggttccatcctcgccaagaaactggccgaagggctggatgcgctggta
atggacgtcaaagtcggcagcggcgcgtttatgccaacctatgaactttctgaagccctt
gctgaagcgattgtcggcgtggcaaacggcgcgggagttcgcactacggcgttgttaacc
gatatgaatcaggtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcttgtttgacgtcactatggcgctatgt
gtggagatgctgatctccggccagctggcgaaagacgacgccgaagcgcgtgccaaactg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcggtatatgctgataccgaagggtttatcagcgcaatggatacgcgtgcgctgggg
atggcggtcgtctcgatgggcggcggccgtcgtcaggcgtctgataccattgattacagc
gttggctttaccgacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcg
gtgattcatgccaaagacgaaaccagttggcaggaagcggcgaaggccgtcaaagcggca
attatccttgacgataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaa
tag

DBGET integrated database retrieval system