KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_15550Help
Entry
CFSAN001992_15550 CDS       T02479                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFSAN001992_15550
Enzymes [BR:senj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CFSAN001992_15550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3217094..3218200
Genome map
AA seq 368 aa AA seqDB search
MTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSYA
MFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDIW
MAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFNP
SYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLIS
SYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVGF
SAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPDW
GQECVSSR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcgcag
gcggcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcaggga
cgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctacgcc
atgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactggacg
caaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtgggggcaa
aaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatctgg
atggcatggtcgcttctggaggccggtcgtctgtggaaagagacgcgttataccgaggtg
ggcacggcgttgctaaaacgcatcgcccgcgaagaggtcgtgaatgtgccggggctgggc
tcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaaccca
agctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcgacg
ctacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccggac
tgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatcagt
agctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccgcaa
aaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggcgtt
ccaccggagaaagtggatgtcgtcagcgggaacgcgcaagggacggggccggtcgggttt
tccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacagcgg
gtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctctttgga
caaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgactgg
ggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system