KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_18355Help
Entry
CFSAN001992_18355 CDS       T02479                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
3798326..3799039
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYV
TDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVK
PASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgttttatgatgttcactttactggcggcggcgttttcaggcgtggcccat
gcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagtacggaaatt
caggcctctccagtggcaggaatgaaaaccgtcctcactcacagcggcgtactgtacgtc
actgacgacggcaaacatattattcaagggccgatgtatgacgtgagcggcgcgcatccg
gtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaagagatgatc
gtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatcacctgcggc
tattgtcataagctacatgaagagatgaaagattataacgcgctggggatcacggtacgt
tatctggccttcccgcgccaggggctggaaagccaagcggagcaggatatgaaatctatc
tggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaagggcgtgaaa
ccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcagttgggcgtt
agcggtacgccagccattgtattgagtaacggctatgtggtgcctggctatcagggaccg
aaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaataa

DBGET integrated database retrieval system