KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_13190Help
Entry
SN31241_13190     CDS       T02779                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SN31241_13190
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SN31241_13190
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SN31241_13190
Enzymes [BR:senn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SN31241_13190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1357328..1358467
Genome map
AA seq 379 aa AA seqDB search
MVFISYFERQRIMSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIV
TSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADM
EDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLL
TDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAG
IDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAM
LERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDA
ILGYEYGPVAVHRDDMITR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttggtctttatttcttattttgaacggcagagaatcatgagtgacagccagacgctggtc
gtaaaactcggcaccagcgtgctaacaggcggatcgcgccgcctgaaccgtgcccatatc
gtagaacttgtccgccagtgcgcgcagctacacgccgcgggacatcgtattgttattgtt
acctctggcgcgattgccgccggacgtgaacatctcggctacccggaactgccggcaacg
atcgcctctaaacagcttctggcggcggtagggcaaagccgcctgattcaactgtgggag
cagttgttttcaatttacggtatccatatcgggcagatgctgttgacgcgtgcggatatg
gaagacagagagcgctttctgaacgcccgcgatacgctacgtgcattactggataaccat
attgtgccggttatcaatgaaaatgatgccgttgcgacagcggaaattaaagtgggcgat
aacgataacctctccgcgctggcggctatcctggcaggcgcggataaactgctgctgctg
accgatcagcaaggattatttaccgccgatccgcgtagcaatccgcaggcggagcttatc
aaagatgtgtatggcgttgacgatgcgctgcgctctatcgcgggagacagcgtttccggg
ctgggaaccggtggtatgagcactaagcttcaggcggcagacgtggcctgtcgcgcgggt
attgatacgattattgcctcaggcagtaaaccgggcgtgatcggcgatgtgatggagggg
atttccgtcggcacccgttttcatgcgcaagcctcgccgctggagaaccgcaaacgttgg
atcttcggcgcgccgccggcaggtgaaattacggttgatgaaggcgcgaccgcggcaatg
ctggaacgtggcagttcacttctgccaaaaggcatcaaaagcgtgacgggcaatttctcg
cggggggaggtcatcagaatttgtaacctgcaagggcgtgatattgctcatggcgtcagc
cgttataacagtgatgctctgcggcggatagccggtcaccactctcaacaaatcgatgcg
attctgggctatgaatatggcccggtcgctgttcatcgtgatgacatgattactcgataa

DBGET integrated database retrieval system